KEGG   Thermoplasma volcanium: TVN1287Help
Entry
TVN1287           CDS       T00042                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN1287
   01230 Biosynthesis of amino acids
    TVN1287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVN1287
   00051 Fructose and mannose metabolism
    TVN1287
   00562 Inositol phosphate metabolism
    TVN1287
Enzymes [BR:tvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TVN1287
Exosome [BR:tvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TVN1287
  Exosomal proteins of bladder cancer cells
   TVN1287
  Exosomal proteins of melanoma cells
   TVN1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1351870..1352511)
Genome map
AA seq 213 aa AA seqDB search
MFTVIVNLKNYAEANGKNFVEFVSKLPKYDSVRLIIAPAILDLHNAHEFRNVEFFSQHVD
DVGYGPYTGHIAIESLMNYGIIGSLLNHSERRLGEDKIISTVKKAQMLGFEIALCVESME
EAKRYSALKPSFIAYEPKELIGGNVSVSTAKPEIISEIVDICGTEGVPVLVGAGIKNRQD
VRKSLDLGAQGILVSSGVVKSPDPVRSLNSLIK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgtaatagttaatttgaaaaattatgcagaagctaatgggaagaattttgta
gaatttgtttccaaactgccaaaatacgacagtgtccgtttgataattgcacctgctatt
ttagatctgcataatgcgcatgaatttaggaatgttgagtttttttcgcagcacgtggat
gatgtgggatatggtccgtacacaggccacatagctatagaatcgcttatgaattacggt
ataataggttccttgcttaatcattcagagaggcgattgggtgaggacaagatcatttca
acggtaaagaaagcgcagatgctagggtttgaaatagccctttgcgttgagtcaatggaa
gaagcaaaaaggtattctgcacttaagccgtcgttcatagcctatgaacctaaagagtta
attggcggaaacgtgtccgtatcgactgcaaagcctgaaataataagtgaaatcgttgat
atatgcggtacagaaggagttccagtgcttgtcggtgcagggataaaaaacaggcaggac
gtaaggaaatcgctggatctaggggcacaaggaatactcgtatcttctggcgtagtcaag
agtccagatccagtaagatcgttaaattcattaataaagtaa

DBGET integrated database retrieval system