KEGG   Thermoplasma volcanium: TVN1445Help
Entry
TVN1445           CDS       T00042                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tvo  Thermoplasma volcanium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVN1445
   01230 Biosynthesis of amino acids
    TVN1445
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVN1445
   00030 Pentose phosphate pathway
    TVN1445
   00051 Fructose and mannose metabolism
    TVN1445
  Energy metabolism
   00680 Methane metabolism
    TVN1445
Enzymes [BR:tvo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TVN1445
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TVN1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520544..1521671)
Genome map
AA seq 375 aa AA seqDB search
MKVTISHIKADIGSLPGHSLVDEKVMERIREYIEDHGKNLVSDFRMAHVGDDAQITMVHT
KGVDSEEVHELAWNAFKAGTEVAKKLGLYGAGQDLLKDSFSGNLKGMGPGVAEMEITERP
SEPFIVYMMDKTEPGAFNLPIYKMFADPFNTPGLVIDETMHEGFRFEIWDVIEHKAIMLE
APSDLYDILAMIGSKSRYVIKRVYTKPAHKKLPDENVAVISTDKLSLIAGKYVGKDDPAA
VVRLQSGLPAAGESLEAFAFPYFVSGWMRGSFNGPIMPVSMKDAKMTRFDGPPRVVALGY
VLKGGKLEGPVDMFDDPAFDYARRVAGELTDHIRRMGPFEPHRLPDQEMEYTTLPAVVEK
LKNRFVDIEKQEVAK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaactatttcgcacataaaagctgatataggtagtcttccaggacattcgtta
gtggacgagaaggttatggagagaataagagaatatatagaagaccatggtaaaaatctg
gtatctgattttaggatggcgcatgttggtgacgatgcccaaataactatggtgcatact
aaaggcgtcgacagtgaagaggtacacgagcttgcatggaatgcttttaaagccggtact
gaagtagcaaagaagcttgggttatacggagcaggccaagaccttcttaaggattcgttc
tcaggaaacttgaaaggcatgggccccggagtagctgaaatggagataacagaacgacca
tctgaaccgtttatagtttatatgatggacaagactgaacccggagcgtttaatctccca
atatacaagatgtttgcagatccgtttaacacccctggccttgtaatagacgaaactatg
cacgaaggtttccgttttgaaatatgggatgtgatcgaacataaagcaattatgctggag
gcgccatcggatctttacgatatacttgccatgataggttctaaatcaaggtatgtcata
aaacgagtctacacaaagcctgcgcacaaaaaattgcctgatgagaatgttgcggtaatt
tctactgataaactctccctgatagcaggcaagtatgttggcaaagatgatcctgcagcc
gtagtgaggcttcagtctgggcttccagctgctggcgaatcactggaagcattcgctttt
ccttattttgtgtcaggctggatgaggggttcgtttaatggcccaattatgcctgtgtca
atgaaagatgcaaagatgactaggtttgacggtccgccgcgtgttgttgcccttggatac
gtccttaaaggtggaaagctggaagggcctgtcgacatgttcgatgatcccgcttttgac
tacgctagaagggttgcaggcgaacttacagaccacattaggaggatggggccgtttgaa
cctcacaggctgccagatcaggagatggagtacacgacgcttccagcggtagttgaaaaa
cttaagaatagattcgttgatatagaaaagcaagaagtagcgaagtaa

DBGET integrated database retrieval system