KEGG   Tropheryma whipplei Twist: TWT031Help
Entry
TWT031            CDS       T00116                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
twh  Tropheryma whipplei Twist
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:twh00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:twh00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
31903..32526
Genome map
AA seq 207 aa AA seqDB search
MELRNLKVNGCLEVTPEVHVDSRGSFSEVYRFDVLEKEIGYPLRVAQVNRSFSKKAVLRG
LHYSLAPHSQAKYVMCANGAVLDFVFDLRLGSPSFGVWDAVLLDSVGCRAVYIPEGVGHA
FIALSKTATVNYLCSATYDPEREKSINPLDKNLNLEYPFTTPEIVLSERDAAAPTLPEAQ
KGGFLPKWDECRWDECRATPETHGNIR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacgtaatcttaaagttaacggctgcctcgaggttaccccagaggttcatgtg
gactccaggggttcattctctgaggtgtaccgttttgatgttttggagaaagagattggg
tatccgctccgggttgctcaggtaaatcgttctttttccaagaaggctgttctgcgaggg
ctgcattactctcttgcgccgcactctcaggcaaagtacgttatgtgtgcgaatggcgca
gtgttagattttgtgtttgaccttcgcttggggtcaccgagtttcggggtgtgggacgcg
gtcctgctcgactctgtaggttgtagggctgtttacatcccagaaggggttggtcacgcg
tttattgcgttatccaagactgccactgtgaactacttgtgcagcgcaacctacgatccg
gagcgagagaagagtattaatccgctcgataaaaatctcaatctagaataccctttcact
actcctgaaatagtgttatccgagagggatgctgctgccccgactttacctgaagcgcaa
aagggtggtttcctgccaaaatgggatgaatgccggtgggatgaatgccgggcaacaccc
gagacacacggaaacattcgataa

DBGET integrated database retrieval system