KEGG   Tropheryma whipplei Twist: TWT213Help
Entry
TWT213            CDS       T00116                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
twh  Tropheryma whipplei Twist
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TWT213 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TWT213 (glkA)
   00052 Galactose metabolism
    TWT213 (glkA)
   00500 Starch and sucrose metabolism
    TWT213 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    TWT213 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TWT213 (glkA)
   00524 Butirosin and neomycin biosynthesis
    TWT213 (glkA)
Enzymes [BR:twh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TWT213 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
297460..298404
Genome map
AA seq 314 aa AA seqDB search
MYFVFLRAVLVRAIGVDIGGTKISAALVDRSGNMDGQLTVPTDPVGVIDQVVELVNKLSD
GESVCAVGVAVASFLNYSRDFVYNSPNLGLENIPIRNLLQNRIKFPVFIENDANAAAWAE
WRFAPRSVEIVNSQDLFMITVGTGVGGAAILDGKILKGGFGIASEPGHIVLVPDGIPCGC
GKRGCSEQYASGTALLRYVKSNMPDFPFGRNPSDVIGELVAKSDPVVLSAVSQVADNVGR
TAAAVTAILDPELFVIGGGVSKIGTFFIDSIRESYKEYLPHSESRPCANFRLAHFYNTAG
IIGAADLARSSLAT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgtattttgtatttctgagagcggttttggtgcgtgcaatcggcgttgatatcggaggg
acaaagatatcggcggcattggttgatagatctggcaatatggacggccagcttactgtg
ccgacagatcccgttggtgttattgatcaggtcgtggagcttgtcaataaactgtctgat
ggtgaatcggtgtgtgcagttggtgttgctgttgccagtttcctaaattatagtcgtgat
tttgtttataattctcctaatttggggctggaaaatattccgatacgcaaccttttgcaa
aacagaattaaatttcccgtttttatagagaatgatgcaaatgccgccgcgtgggctgag
tggcgttttgctccgcgatctgtggagattgttaattcacaagatttgtttatgattact
gttggtaccggtgtgggtggagcggcaattttagacggcaagatccttaaggggggtttt
ggtatcgcttcggagccggggcatattgtccttgtgccagacggcattccgtgtggttgt
ggcaaacgtggctgcagtgagcagtatgcttctgggactgcgcttttgcgttatgtaaag
agcaatatgccagattttccgtttggtaggaacccgtctgatgtaattggcgagcttgtt
gccaagtcggatccagttgttctttctgccgtttctcaagtcgcagataacgtgggtcgc
acagcagctgctgttaccgctattttggaccctgagttgtttgttatcggtggtggggtc
agtaaaatcggcaccttttttattgattcaataagagagtcttataaagaatatttaccc
cattcagagtcacggccgtgtgctaattttcgattggcccatttttacaatactgctggg
attataggcgcagcagacttggcaaggtcttctcttgctacttga

DBGET integrated database retrieval system