KEGG   Tropheryma whipplei Twist: TWT268Help
Entry
TWT268            CDS       T00116                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
twh  Tropheryma whipplei Twist
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:twh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TWT268 (ruvA)
Enzymes [BR:twh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TWT268 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
351182..351850
Genome map
AA seq 222 aa AA seqDB search
MAISTRGQFDRAGSVSVCICIACARGLALIASLSGLLEAVRPGSVVVNMHGIGFLVRVPQ
SFNPEVDAEVKLYTSLQVREDSVSLYGFASVLECTVFEQLITISGVGPRVALAILSVLTP
AEVAAAVLEGDDKPLQRVSGVGKKLAGTIVLQLAGKLTSVPLENRKQEQAVDRSAEIVQA
LIGLGWQRQESAAAVESVLEKDQSLTMPEILRNALRYLAKQE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagcactcggggccagttcgacagagcggggtcggtaagtgtctgtatatgc
attgcttgcgccagagggcttgctttgatcgcgtcactttctggattgttggaggctgta
cgtcccggcagtgttgttgtgaacatgcatggtataggctttttggttcgtgtgccacaa
tcttttaaccctgaagtagatgctgaggtaaaactttataccagtcttcaagtccgagaa
gactcggtttcgctttacggttttgcatctgttctggaatgcactgtttttgaacagcta
ataacaatatccggtgttggcccgcgggttgcgcttgccatcctttcggttttgaccccg
gcagaggttgctgcggccgttctggaaggtgatgacaagcccttgcagcgagtgagtggt
gttggaaaaaagcttgccggaacaatagtgttacagcttgctgggaaattgacttcggtc
ccattagagaacaggaaacaggaacaagcggttgatagaagtgccgagattgtccaggct
cttattgggttgggctggcagcgacaggaatctgctgcggccgtggaatctgttttagaa
aaagatcagtctttgactatgccagaaattttgagaaatgcccttagatatcttgcaaaa
caggaataa

DBGET integrated database retrieval system