KEGG   Tropheryma whipplei Twist: TWT302Help
Entry
TWT302            CDS       T00116                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
twh  Tropheryma whipplei Twist
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TWT302 (tpi)
   01230 Biosynthesis of amino acids
    TWT302 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TWT302 (tpi)
   00051 Fructose and mannose metabolism
    TWT302 (tpi)
   00562 Inositol phosphate metabolism
    TWT302 (tpi)
Enzymes [BR:twh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TWT302 (tpi)
Exosome [BR:twh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TWT302 (tpi)
  Exosomal proteins of bladder cancer cells
   TWT302 (tpi)
  Exosomal proteins of melanoma cells
   TWT302 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
388933..389814
Genome map
AA seq 293 aa AA seqDB search
MLPKRAYPVQDSNVHSQEKKIIAGNWKMNINHSQAVSYLQELNWRLIDNGHDFDSCEIAV
FPPFTDLRSVQTLVASDDIQISYGAQDVSAFSDGAHTGQISAQFLKDLDCKYVLIGHSEQ
RCLPCYPGNNSAINELNNKHDGLIANKLLRSFAAGICPILCIGDISPGDHFDATLSRFRS
VLSHLKAISDKKHSIGYALGSKTHFLDSDQLHMLVAYEPSSAINSGNCANSGDIVRMAAA
IKDIVNVRVLYGGGVNLFNASAVFNEDLLDGILVGRASLNASDFASLIKTCCL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaaagcgcgcgtatcccgtgcaagactcgaatgttcactctcaagagaaaaaa
ataattgccggcaattggaagatgaacataaatcatagtcaggctgtttcgtatttacag
gagctcaactggaggcttattgataatggtcatgattttgattcctgtgagattgcagta
ttcccgccgtttactgatcttcgttccgtacaaactctcgttgcatcggatgacatacag
atatcatacggagcccaggatgtctccgcattttcagatggcgcacatacaggtcagatt
tcagcccagtttttgaaagatctagactgcaagtacgtcctaataggtcattcagagcaa
agatgtttaccatgctaccccggcaacaatagtgcaatcaatgagctcaataacaagcac
gacggtcttattgcaaataaattattgagaagctttgcggcggggatttgtccgatcttg
tgtattggtgatatttcaccgggtgatcattttgatgcaactctgtctagatttcgttct
gttctaagtcacctcaaagcgatatcagataaaaaacatagcatcggttacgcccttgga
tccaaaacacactttttagatagcgatcagttacacatgttggttgcttatgaaccctca
tcggctattaactcgggaaactgtgcaaattcaggggacattgtcaggatggctgcagca
ataaaagacattgtaaatgttcgggtgctctacggtgggggagtgaatctatttaacgca
tctgcagtttttaacgaggatttgctagacggcattcttgttggcagagcttccttgaat
gcatctgatttcgcatccctgataaagacgtgctgtttgtaa

DBGET integrated database retrieval system