KEGG   Tropheryma whipplei Twist: TWT326Help
Entry
TWT326            CDS       T00116                                 

Gene name
adh
Definition
zinc-type alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
twh  Tropheryma whipplei Twist
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TWT326 (adh)
Enzymes [BR:twh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     TWT326 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
407213..408286
Genome map
AA seq 357 aa AA seqDB search
MVRMKALVYHGPGKRSLDTVDDPTIKLGTDVILEMETTTICGSDLHILKGDVAAVKPGTV
LGHEGIGKIVEVGKDVKSHSVGDRVIVSPMSSCGVCRFCRANNNGHCLGDSEGPGGWRLG
GLINGVQAQFARIPLADNSLHKLPSGLDPKVGILVSDVLPTGHEVGAQAGQVTLGSVVAV
IGCGPVGLGAIVTSLLYSPSKVIAVDADSNRLELARKLGATDTVRVNRERPLDAIEDVKK
LTEGGFGVDVAIEAVGVPVTFSMALGIAAPGGRVANIGVHGAPVDFPLQDLWDKNIAVTL
GIVSTHTIPLLLAALSEGKIDASQFVTHEFDLSDLERAYDVFSAAAQHNVVKVAIRA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgcatgaaagcgcttgtttatcacggacctggaaaaaggagtctggacacagtt
gatgacccgactataaagcttggcacggatgtcatccttgaaatggagactactacgata
tgcggtagtgatcttcatatcctcaaaggtgatgttgcggccgtgaaaccgggtactgtg
ctcggacatgaagggattgggaagatagttgaggtcggtaaagacgttaaatcccattcg
gttggcgatcgtgttatcgtctctccaatgtcttcctgcggggtttgtaggttctgtagg
gcgaataataacggtcattgtctgggtgattcagagggtcccgggggatggcgtcttggt
ggtctgattaacggggttcaagctcagtttgccaggataccgcttgcagataattcactt
cacaaacttccctctggcctcgatccaaaggttggcatattggtgtctgatgttcttccg
actggccatgaagtgggtgcacaggctgggcaggttactctcggtagtgtagttgccgta
attggctgcggccctgttggattgggcgcaattgttacgagcttgctttactcaccttca
aaggtaattgcagttgatgctgactctaaccgtcttgagttagcccgaaagttgggtgcg
acagataccgtgcgtgtcaatagggaaaggcctcttgatgcaattgaagatgttaagaag
ctcacagaaggtggcttcggggtcgatgttgcgatagaggcggttggtgttccggtaact
ttcagtatggcgcttgggattgctgcgcccggtgggagagttgccaatattggtgttcat
ggggcaccggttgactttcccctccaagacctgtgggacaaaaacattgccgtaacactg
ggcattgttagtacacatacgattcccctccttcttgctgcgctttctgagggcaaaatc
gatgcaagtcaattcgttacacatgagtttgatctgtccgatttggagagggcgtatgat
gttttctctgctgcggctcaacacaacgtcgtcaaggtagctattagagcttaa

DBGET integrated database retrieval system