KEGG   Tropheryma whipplei Twist: TWT438Help
Entry
TWT438            CDS       T00116                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
twh  Tropheryma whipplei Twist
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TWT438 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TWT438 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TWT438 (thrC)
Enzymes [BR:twh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TWT438 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(530360..531412)
Genome map
AA seq 350 aa AA seqDB search
MYFRGIINEYRSRLGLDADLKVVTLGEGNTPLVYSEALSSLTASSVWLKFDGANPTGSFK
DRGMTVAVSKAVNSGVRTVICASTGNTSASAAAYSAAAGIECVVLIPEGFVSHGKLCQAV
AHGARVLQIRGNFDSCLRVARELAEIHPVHLVNSINPDRISGQKTAAFEIIDALGDAPDY
HYLPVGNAGNYTAYYLGYSEEKVRGNSTHIPRIFGFQASGAAPIVSGHIVENPQSIATAI
RIGNPASWKQALHAQHACNGYFGSIDDSGILEAQKLLARTCGLFVEPASAISVAGLLASK
PPEGSSVVCTLTGHGLKDQQLAFRKSDGTEYSLPSLPGDSQSIASYLNLA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtattttagagggattatcaacgagtacagatcacgcctggggcttgacgcggacctt
aaggttgttacccttggtgagggtaataccccccttgtgtattcagaagctctgtcgagc
ctaactgcctcttctgtgtggttaaagtttgatggcgctaacccaactgggtcgttcaaa
gatagaggtatgacagttgccgtatcaaaagctgtgaattcgggcgtgcgcacggttatt
tgcgcatcaacaggtaacacttctgcttcagccgcagcttattccgccgctgcaggtata
gagtgcgttgttctcatccccgagggcttcgtaagtcatggtaagttgtgccaggctgtc
gcacacggcgcgagagttttgcagattagaggaaattttgattcatgcctcagagtggct
agggagctcgcagaaattcaccccgtacaccttgtaaactcaataaatccagaccgtata
agcggacaaaaaactgctgcgtttgagataattgatgccctgggggatgcgccagattac
cattatcttcctgttggtaatgctggtaattacacggcatactatcttggatacagtgaa
gagaaagttcgtggaaacagtacccatattccgcgtattttcggctttcaggcaagtggt
gctgctccgattgtctcagggcatattgttgaaaatccgcagtcaatagcaactgctatt
cgtattggcaatccggcttcttggaaacaggctctgcatgcccaacacgcgtgtaatggt
tattttgggagtatagatgattcaggcatcctcgaggcacagaaattattggcacgcact
tgtgggttatttgttgaaccggccagtgcgataagcgttgcaggccttcttgcctcaaaa
cccccagagggcagtagtgttgtgtgcactctaactggccatggattgaaggatcaacag
ctggcctttcgtaaatctgatggcacagagtattcccttccgtcattacccggtgattcg
caatcaatagcttcatatttgaatctcgcgtga

DBGET integrated database retrieval system