KEGG   Tropheryma whipplei Twist: TWT503Help
Entry
TWT503            CDS       T00116                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
twh  Tropheryma whipplei Twist
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:twh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:twh00020]
Metabolism; Amino acid metabolism; Lysine degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
603184..604569
Genome map
AA seq 461 aa AA seqDB search
MSEDFILPALGESVSECVITRWLKEAGDRVEVDEPLVEVSTDKVDTELPSTLTGILEEIL
VQRDETAKPGQILARIAVDKDETKSNFDHGVKQSDVITGDSTGNLLGNTRPIEDTGWPVT
LHTAESKPDLSAKADHIGDEGDKQGNLPTAHNAEIPYATPIVRQLARKLNIDLTNIVGSG
VGNRILREDVLLASNRTTNTSTECAQNIPSSPEHDKSAASFDSEVSELRGTRIKMSRLRN
IIAERAVHSMQNTAQLSTVIEVDLTRIVDYRNSIKEKFKEAEGVNLTVLPFIINATVQAL
RKYPVINSHIVDDQIVFPDYENISLAVDTERGLLTPVIKNAGDMTVAQFAKSVFDLARRA
RNNKLSPDELTGGTFTVTNTGSRGALFDTPVVFLPQLAILGIGAIARRPVIVLDAQGNEC
ISIRSVAFFALSYDHRVIDGADAARFLGYIKSLLETGNCTV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggactttatcctgcccgcattgggtgaaagcgtaagtgagtgcgtcataact
cgctggctcaaagaagctggggatcgggttgaagttgatgaaccactggttgaagtctca
acggataaagttgataccgagcttccgtccactttaactgggatattggaagaaatactt
gttcagcgcgatgaaacggcaaaacctgggcagattctcgctaggatagcagtcgataaa
gatgagacgaaaagcaattttgaccacggggtaaaacaatcagatgtaataacaggggat
tccaccggtaacctgttaggcaatactcgtccaatcgaagatactggatggccagtcaca
ctgcataccgcagagagcaaaccggatctatcagcaaaagcagatcatattggagatgaa
ggcgacaagcaaggcaatttgcctactgcgcataatgcagaaataccgtacgcaacaccg
attgttagacagcttgcaagaaaactgaatattgatctaactaacatagtcgggagcgga
gtgggcaacagaatcctaagggaggatgtattgttggcgagtaaccgcacaacaaatacc
tcaaccgaatgtgctcaaaacatcccatcaagtccagaacatgacaaaagtgccgcaagc
tttgacagcgaagtatcagaactccgtgggacgcggattaagatgtctcgcctgcgcaac
ataatagctgagagggctgttcattcaatgcagaacaccgcacagcttagcactgtaatt
gaggtagatctaacaaggatagttgactatcgcaatagcataaaagaaaaattcaaagaa
gcggagggtgtgaatctaaccgtcctaccgtttataatcaacgccacagttcaagcactt
agaaaatatccagttattaattcccatattgtggatgatcaaatagtttttccggattat
gaaaatatttcacttgctgttgacaccgaaagagggttgctgacacccgtaataaaaaac
gctggagatatgacggtggcgcaatttgcaaaaagtgtttttgatctggcgcgaagggca
cgtaacaacaaactatctccagatgaacttaccggtggaacatttacagtcacgaatacc
ggttcccgaggtgctctatttgatacgccggttgtatttcttccgcaactcgcgattttg
ggaattggtgctattgcaaggcgtccggtaattgtgttagacgcgcaaggaaacgagtgt
atctcgataagatccgtggcgttttttgccctatcgtacgaccatagggttattgatggc
gcggatgctgctaggtttttaggatacataaaatccctgcttgaaacgggaaattgtaca
gtttag

DBGET integrated database retrieval system