KEGG   Tropheryma whipplei Twist: TWT586Help
Entry
TWT586            CDS       T00116                                 

Gene name
folPXK
Definition
dihydropteroate synthase/dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase fusion protein (EC:2.5.1.15 2.7.6.3 4.1.2.25)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01633  
dihydroneopterin aldolase [EC:4.1.2.25]
Organism
twh  Tropheryma whipplei Twist
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TWT586 (folPXK)
Enzymes [BR:twh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TWT586 (folPXK)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TWT586 (folPXK)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     TWT586 (folPXK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(674213..676513)
Genome map
AA seq 766 aa AA seqDB search
MMNMSYTPDPFPPPNVMGILNITDDSFSDGGLFLDPSAAITQGRKLFAEGASIIDVGGES
TRPGAERISVEEEKKRVLPVVRELLSEGIHVSLDTMNADTAKEGLSMGVAIINDVSAGKA
DPDMLRVIADAGCKYIAMHWRGHSMFMDSLAHYDDVVSDVLRELKFDIERITAAGVKSDQ
IILDPGFGFSKTSDHNWQLFRNLDCFVKLGFPVLIGLSRKRFLSRVFKGHDFSPKDSKNV
GGLDNREILARDLPSGILSAIAITRGAWGVRVHDVASAHTALRTLQLAQYGSVYQAHKRA
ANTGIDTAIPGQGNTDDTTASSNHTNNSETGASLKSGVSQVRNMIAPPVIKIRSLRVYAY
HGVYRSERDYGQQFIIDADIQLKHFPEDKIDSTLDYDSLTGKFVQYATASSVNLIETLAD
HLAKIAVLDPMVEWVSLSITKPNPPLAYMKQSNTAACHAMHKPDTRGDYAKEHTNLTGLQ
LSCTVRKVRSESVTRVYIGIGANVGNCLDNVQRAIKDIADHPMIELVSLGRLFRTTAVVG
ESLDESLPVFLNTAIAIDTALSMQDLLALMLCIEKKLGRTRHSRTRHSLSSAQDAHQADS
TSDNPNQLHYPCAGRQGIQQPLHSSTLAHTQDGFVNRHIDLDILLAEGVQITEHGLCIPH
PRLSKRAFALLPLESIDPDLHIPGHGPITDLIHGLPEDQISSVATLRDSGYELFRHSITR
LNNCSAHNKAYVTPSAGQNYDSEQDFDAGLSHTESRGKTEPHGKYE
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaacatgagctatactcccgacccatttccacctcctaatgtaatgggcattctg
aatataaccgatgattctttcagtgatggtggactgtttttagacccctctgctgccatt
acccaaggtagaaagttatttgctgagggtgcttcaataatcgatgttgggggtgaatcg
acacgcccgggtgctgagcggattagcgtggaagaagaaaaaaaaagggttttacccgta
gttagggaacttctatccgaaggtattcatgtaagtcttgacaccatgaatgcagacaca
gcaaaagagggccttagcatgggtgttgccattataaatgacgtatcagcgggcaaagcc
gacccggacatgctaagagtgatagccgatgcaggctgtaaatacatcgcgatgcattgg
cgtgggcactccatgtttatggatagccttgctcattacgacgatgttgtgagtgatgtt
cttcgagagcttaagtttgatatcgagcgtattactgccgctggggtaaagagcgaccag
atcatccttgatcctggttttggcttttctaaaacaagtgaccataattggcagttgttc
agaaaccttgattgctttgttaagctgggctttcccgtgctgattggtctttcgcgcaag
aggtttttgagtcgagtatttaaggggcatgatttttctcctaaagattctaagaatgtt
ggagggttggataaccgcgaaatacttgcgcgcgatctgccaagcgggatactgagtgct
attgccataacacgtggagcatggggcgtgcgtgtacatgatgttgcctcagctcacacg
gcgctgcggactctacagcttgcgcaatacggctcggtatatcaggcccacaaacgggcg
gcaaataccggaatagacaccgcaatacccggccaaggcaacactgatgacaccactgcc
tccagtaaccacaccaacaattctgaaacaggagcttctttaaaaagtggcgtgagtcaa
gtccgcaacatgattgccccgcccgttataaagataagaagtctgcgcgtgtatgcatat
catggggtgtatcgttctgagcgggactacggtcagcaattcattatcgatgcagatatt
caattaaaacattttccagaagacaagattgactcaaccctagactatgactcattgact
ggaaagtttgtgcaatatgccaccgcatcatctgtgaatcttattgagacactcgctgat
caccttgcaaagattgccgtcctagatccaatggttgagtgggtaagcctcagcataaca
aagccaaaccctccgctcgcttatatgaaacaaagtaacacagccgcctgtcatgctatg
cataaacctgataccagaggtgattatgctaaagaacacacaaatcttacaggccttcaa
ttatcgtgcacggttaggaaagtgcgttccgaaagtgtaacaagggtctatataggcatc
ggtgcaaatgtaggtaattgcctggataatgtccagcgcgcgatcaaggatattgcagat
catccaatgattgaacttgtctcactcggcaggcttttccgaaccaccgccgttgttggc
gagagtcttgatgaatctctaccggtatttttgaatactgcaatcgcaatcgatactgct
ttatccatgcaggatttgcttgccttaatgctttgtatagagaaaaagcttggaagaact
cgtcacagtagaactcgtcacagtttatcttccgctcaagacgcccaccaggctgattca
actagcgataatcctaaccagttacattatccttgtgccggacgccaaggcatccaacag
cctttacattcgtcaactttggcgcacactcaggatgggtttgttaatcggcatattgac
cttgatatcctgctcgcggagggggttcaaattactgaacacgggttatgtattccacat
ccaaggctcagtaagagagcctttgcgcttttgccacttgagagtatagatcctgatctg
catatccccggacatggcccaattactgacttgatacatggtcttcctgaggatcaaata
agctctgttgctacccttcgagattccgggtatgaattattcaggcactctattaccaga
ctaaacaattgttcagcgcataataaagcgtatgttactccgtcagcgggccagaattat
gattctgaacaggattttgatgctggattgtcacacacagaatcacgcggaaaaacagag
ccacacggaaaatatgaataa

DBGET integrated database retrieval system