KEGG   Tropheryma whipplei Twist: TWT586Help
Entry
TWT586            CDS       T00116                                 

Gene name
folPXK
Definition
dihydropteroate synthase/dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase fusion protein (EC:2.5.1.15 2.7.6.3 4.1.2.25)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01633  
dihydroneopterin aldolase [EC:4.1.2.25]
Organism
twh  Tropheryma whipplei Twist
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:twh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(674213..676513)
Genome map
AA seq 766 aa AA seqDB search
MMNMSYTPDPFPPPNVMGILNITDDSFSDGGLFLDPSAAITQGRKLFAEGASIIDVGGES
TRPGAERISVEEEKKRVLPVVRELLSEGIHVSLDTMNADTAKEGLSMGVAIINDVSAGKA
DPDMLRVIADAGCKYIAMHWRGHSMFMDSLAHYDDVVSDVLRELKFDIERITAAGVKSDQ
IILDPGFGFSKTSDHNWQLFRNLDCFVKLGFPVLIGLSRKRFLSRVFKGHDFSPKDSKNV
GGLDNREILARDLPSGILSAIAITRGAWGVRVHDVASAHTALRTLQLAQYGSVYQAHKRA
ANTGIDTAIPGQGNTDDTTASSNHTNNSETGASLKSGVSQVRNMIAPPVIKIRSLRVYAY
HGVYRSERDYGQQFIIDADIQLKHFPEDKIDSTLDYDSLTGKFVQYATASSVNLIETLAD
HLAKIAVLDPMVEWVSLSITKPNPPLAYMKQSNTAACHAMHKPDTRGDYAKEHTNLTGLQ
LSCTVRKVRSESVTRVYIGIGANVGNCLDNVQRAIKDIADHPMIELVSLGRLFRTTAVVG
ESLDESLPVFLNTAIAIDTALSMQDLLALMLCIEKKLGRTRHSRTRHSLSSAQDAHQADS
TSDNPNQLHYPCAGRQGIQQPLHSSTLAHTQDGFVNRHIDLDILLAEGVQITEHGLCIPH
PRLSKRAFALLPLESIDPDLHIPGHGPITDLIHGLPEDQISSVATLRDSGYELFRHSITR
LNNCSAHNKAYVTPSAGQNYDSEQDFDAGLSHTESRGKTEPHGKYE
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaacatgagctatactcccgacccatttccacctcctaatgtaatgggcattctg
aatataaccgatgattctttcagtgatggtggactgtttttagacccctctgctgccatt
acccaaggtagaaagttatttgctgagggtgcttcaataatcgatgttgggggtgaatcg
acacgcccgggtgctgagcggattagcgtggaagaagaaaaaaaaagggttttacccgta
gttagggaacttctatccgaaggtattcatgtaagtcttgacaccatgaatgcagacaca
gcaaaagagggccttagcatgggtgttgccattataaatgacgtatcagcgggcaaagcc
gacccggacatgctaagagtgatagccgatgcaggctgtaaatacatcgcgatgcattgg
cgtgggcactccatgtttatggatagccttgctcattacgacgatgttgtgagtgatgtt
cttcgagagcttaagtttgatatcgagcgtattactgccgctggggtaaagagcgaccag
atcatccttgatcctggttttggcttttctaaaacaagtgaccataattggcagttgttc
agaaaccttgattgctttgttaagctgggctttcccgtgctgattggtctttcgcgcaag
aggtttttgagtcgagtatttaaggggcatgatttttctcctaaagattctaagaatgtt
ggagggttggataaccgcgaaatacttgcgcgcgatctgccaagcgggatactgagtgct
attgccataacacgtggagcatggggcgtgcgtgtacatgatgttgcctcagctcacacg
gcgctgcggactctacagcttgcgcaatacggctcggtatatcaggcccacaaacgggcg
gcaaataccggaatagacaccgcaatacccggccaaggcaacactgatgacaccactgcc
tccagtaaccacaccaacaattctgaaacaggagcttctttaaaaagtggcgtgagtcaa
gtccgcaacatgattgccccgcccgttataaagataagaagtctgcgcgtgtatgcatat
catggggtgtatcgttctgagcgggactacggtcagcaattcattatcgatgcagatatt
caattaaaacattttccagaagacaagattgactcaaccctagactatgactcattgact
ggaaagtttgtgcaatatgccaccgcatcatctgtgaatcttattgagacactcgctgat
caccttgcaaagattgccgtcctagatccaatggttgagtgggtaagcctcagcataaca
aagccaaaccctccgctcgcttatatgaaacaaagtaacacagccgcctgtcatgctatg
cataaacctgataccagaggtgattatgctaaagaacacacaaatcttacaggccttcaa
ttatcgtgcacggttaggaaagtgcgttccgaaagtgtaacaagggtctatataggcatc
ggtgcaaatgtaggtaattgcctggataatgtccagcgcgcgatcaaggatattgcagat
catccaatgattgaacttgtctcactcggcaggcttttccgaaccaccgccgttgttggc
gagagtcttgatgaatctctaccggtatttttgaatactgcaatcgcaatcgatactgct
ttatccatgcaggatttgcttgccttaatgctttgtatagagaaaaagcttggaagaact
cgtcacagtagaactcgtcacagtttatcttccgctcaagacgcccaccaggctgattca
actagcgataatcctaaccagttacattatccttgtgccggacgccaaggcatccaacag
cctttacattcgtcaactttggcgcacactcaggatgggtttgttaatcggcatattgac
cttgatatcctgctcgcggagggggttcaaattactgaacacgggttatgtattccacat
ccaaggctcagtaagagagcctttgcgcttttgccacttgagagtatagatcctgatctg
catatccccggacatggcccaattactgacttgatacatggtcttcctgaggatcaaata
agctctgttgctacccttcgagattccgggtatgaattattcaggcactctattaccaga
ctaaacaattgttcagcgcataataaagcgtatgttactccgtcagcgggccagaattat
gattctgaacaggattttgatgctggattgtcacacacagaatcacgcggaaaaacagag
ccacacggaaaatatgaataa

DBGET integrated database retrieval system