KEGG   Tropheryma whipplei Twist: TWT655Help
Entry
TWT655            CDS       T00116                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
twh  Tropheryma whipplei Twist
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TWT655 (gpm)
   01230 Biosynthesis of amino acids
    TWT655 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TWT655 (gpm)
  Energy metabolism
   00680 Methane metabolism
    TWT655 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TWT655 (gpm)
Enzymes [BR:twh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TWT655 (gpm)
Exosome [BR:twh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TWT655 (gpm)
  Exosomal proteins of melanoma cells
   TWT655 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(768915..769580)
Genome map
AA seq 221 aa AA seqDB search
MDNLVLLRHGNSLWNQENLFTGWVDVRLSELGEKEAKTAGQLLREANRYPDVLFTSLLTR
SIQTAHIALMEIDRVWLPTFRSWRLNERHYGSLQGKNKAQVLEEFGEEQFNSWRRGYDTP
PPPLHSQADDPRYEEPPPLSESLKDVQNRLLPYWQGVILPHLVAGKVVLVVAHGNSLRAL
VKHLECISDTDVCQLNIPTGIPLVYSIDPSGCATHPGRYLP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggataatctagttttgctacgtcacgggaatagcctatggaatcaagagaatcttttt
actggctgggttgatgttcgcctgagtgaacttggcgagaaagaggcgaaaactgccggg
caactcttgcgtgaagccaacagataccctgatgtcttgttcacctctctgctaacccgt
tctattcaaacggctcatatagcactcatggagatcgatcgtgtttggctgccaactttt
cgtagttggcgattgaacgagagacattacggaagcttacagggtaaaaataaagcccag
gtactggaggagtttggtgaagagcagttcaattcctggcgccgtggttacgatacaccc
ccgccaccgctgcacagccaagctgatgacccccgctatgaggagccaccacccctttca
gagtcactgaaggacgtacagaatagacttctgccttattggcagggtgtgattcttccg
catcttgttgccggaaaggttgttcttgtggttgctcacggaaattctttgcgtgccctt
gtgaaacacctcgagtgcatatcggatacagacgtgtgtcagctcaatattccgactggc
ataccccttgtgtattctattgacccttcgggttgtgcaacacatcccggtagatatttg
ccctag

DBGET integrated database retrieval system