KEGG   Tropheryma whipplei Twist: TWT655Help
Entry
TWT655            CDS       T00116                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
twh  Tropheryma whipplei Twist
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:twh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:twh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:twh00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:twh00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:twh00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(768915..769580)
Genome map
AA seq 221 aa AA seqDB search
MDNLVLLRHGNSLWNQENLFTGWVDVRLSELGEKEAKTAGQLLREANRYPDVLFTSLLTR
SIQTAHIALMEIDRVWLPTFRSWRLNERHYGSLQGKNKAQVLEEFGEEQFNSWRRGYDTP
PPPLHSQADDPRYEEPPPLSESLKDVQNRLLPYWQGVILPHLVAGKVVLVVAHGNSLRAL
VKHLECISDTDVCQLNIPTGIPLVYSIDPSGCATHPGRYLP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggataatctagttttgctacgtcacgggaatagcctatggaatcaagagaatcttttt
actggctgggttgatgttcgcctgagtgaacttggcgagaaagaggcgaaaactgccggg
caactcttgcgtgaagccaacagataccctgatgtcttgttcacctctctgctaacccgt
tctattcaaacggctcatatagcactcatggagatcgatcgtgtttggctgccaactttt
cgtagttggcgattgaacgagagacattacggaagcttacagggtaaaaataaagcccag
gtactggaggagtttggtgaagagcagttcaattcctggcgccgtggttacgatacaccc
ccgccaccgctgcacagccaagctgatgacccccgctatgaggagccaccacccctttca
gagtcactgaaggacgtacagaatagacttctgccttattggcagggtgtgattcttccg
catcttgttgccggaaaggttgttcttgtggttgctcacggaaattctttgcgtgccctt
gtgaaacacctcgagtgcatatcggatacagacgtgtgtcagctcaatattccgactggc
ataccccttgtgtattctattgacccttcgggttgtgcaacacatcccggtagatatttg
ccctag

DBGET integrated database retrieval system