KEGG   Tropheryma whipplei Twist: TWT709Help
Entry
TWT709            CDS       T00116                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
twh  Tropheryma whipplei Twist
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:twh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TWT709 (recR)
DNA repair and recombination proteins [BR:twh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TWT709 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(822916..823512)
Genome map
AA seq 198 aa AA seqDB search
MYVRIVQDLIRELGKLPGIGPKSAQRITFFILQNPSFDIDRLSETLQSVRKQVQFCKVCG
NFSEEDECVICSDPRRDRGVICVVEEPKDVVAIEKTREFSGLYHVLGGAISPIDGVGPDD
LNIRQLLQRLADGTITEVVLATDPNMEGEATASYIARVISAMRIRVSKLASGLPVGSDLE
YADEITLGRALEGRQYIN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttcgcatagttcaggatctaatacgtgagcttggcaagctacccggcataggt
ccgaagtctgcacagcgcattaccttcttcattttgcagaacccgagttttgatatcgac
aggctatctgagactctccagtctgttagaaaacaggtgcagttctgtaaggtttgtggc
aatttctcggaagaagatgagtgtgtaatttgctcggatccgaggcgtgataggggggta
atttgcgttgttgaagagccaaaggatgttgttgcaatagagaaaacgcgcgaattttct
ggcctgtaccatgttctggggggtgcaatcagcccaatagatggggtaggccctgatgac
cttaacataaggcagcttttacagcggctggccgatggcacaataacagaggttgttctg
gcgacagacccaaatatggaaggcgaggcgacggcaagctatatagcaagggtcatttca
gctatgcgaataagagtttctaaacttgcctcaggcctcccggttggaagtgatcttgaa
tacgcggacgaaattaccctcggtagggcactcgagggtaggcaatatataaattaa

DBGET integrated database retrieval system