KEGG   Tropheryma whipplei Twist: TWT731Help
Entry
TWT731            CDS       T00116                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
twh  Tropheryma whipplei Twist
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:twh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TWT731
Enzymes [BR:twh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TWT731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CNRS_Marseille: 
UniProt: 
Position
complement(843064..843789)
Genome map
AA seq 241 aa AA seqDB search
MRHSCHHVWITRGGQWAREIAGMLKVRGVTSVVHPVIDCVPVMGYENELQKIPFFDWLIV
TSSTTAGLLNTPIPQSVKVAAVGRETAESLIRAGHRVSLCPENDFSSDGLASAIQAHLNF
PRRTCDSVISQRILILTSDLSEGFLKSALERMGHKVTVLVIYKTVILDIPPMPQLDNITA
AFVTSGSIAQGIAKTGLFFDLPLVCIGHKTAEICQRSGLRVASIARTKNKEGLVQALFEL
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagacactcttgccaccatgtatggattacccgaggcgggcaatgggcgcgcgaaatt
gccggtatgctcaaagtccggggggtaacgagtgttgtacatcccgtgattgattgtgtg
ccagtaatgggctatgaaaatgaactccagaaaattccattttttgactggcttattgtg
acaagttcgactactgcaggattgctcaatacccctattcctcagtccgtcaaggtggct
gcagttgggagggaaactgccgagtctctgatccgtgctgggcacagagtttctttgtgc
cccgaaaatgattttagttcagatgggcttgcaagcgccatacaggcccatctgaatttt
ccgcgcagaacgtgtgacagtgtcatttcgcagcgtattctgattctgacatcggatctt
tctgaaggtttcctaaaaagtgcactcgagcgtatgggacataaagtaacagttctggtt
atatataaaacagttatcttggatattccgccaatgccgcagttagacaacatcactgca
gcgtttgtgacaagtggaagtatcgcgcagggcatagccaaaacaggcctgttttttgat
ttgccacttgtgtgtataggtcacaagacagccgaaatttgtcaacgcagcgggctgcga
gttgcttcaattgcaaggactaagaataaagagggtcttgtacaggcgctttttgaactg
agttag

  All links  
No link information was found.   
DBGET integrated database retrieval system