KEGG   Thermoanaerobacter wiegelii: Thewi_0061Help
Entry
Thewi_0061        CDS       T01607                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:twi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thewi_0061
DNA repair and recombination proteins [BR:twi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thewi_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
61891..62490
Genome map
AA seq 199 aa AA seqDB search
MNYYSASLAKLIEELSKLPGIGLKTAQRLAFFIINMPPEEVKSLSQAIIDAKEKIKYCRI
CYNITDTEVCNICSDKERDHSLICVVSHPMDVVAMEKIREYKGVYHVLHGVISPIEGVGP
EDIKIKELLDRVKNGNIKEVILATNPDIEGEATAMYIAKLLKPLGIKVTRIAHGVPVGGD
LEYTDIVTLSRALEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactattattctgcatctttagcaaagcttatagaagaactgtcgaagttgcctggt
attggccttaaaacagcacaaaggcttgcttttttcataataaacatgccgccagaagag
gtaaaaagcttatctcaagcgattatcgatgcaaaagaaaagataaagtattgtagaatt
tgttataacataactgatacagaggtttgtaacatatgtagtgataaagaaagagatcat
tctcttatatgtgttgtttctcatcctatggatgttgtcgcaatggagaaaatacgagaa
tataaaggagtatatcatgtacttcatggtgttatttctccgatagaaggcgttggccct
gaagatataaaaattaaagaacttttagacagagttaaaaatggaaatataaaagaagtt
atacttgctacaaatcctgacatagaaggagaagcgacggcaatgtacattgctaagcta
ttaaaaccgttaggaataaaagttacaagaattgctcatggtgtgccagtaggcggtgac
ctggaatacaccgatattgtgactctttcaagggctcttgaaggtagaagggaattgtaa

DBGET integrated database retrieval system