KEGG   Thermoanaerobacter wiegelii: Thewi_0191Help
Entry
Thewi_0191        CDS       T01607                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:twi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
202094..202729
Genome map
AA seq 211 aa AA seqDB search
MDIRQEVVKMAQEAEKYGLIKYKSGNFSVRDKYSGYIYITPSWIPREELTPEIISVLDGS
GKILSSVYKPSAEYLMHVKIYQNRSDVFAICHSHSLYATTFAIANIEIPPVSREAVHYGA
ITIPVADYAPPGSEELADNVVKTLGQYDCCLLRNHGVVTVGKNAEDALIKLVYVEENAKE
FFNLKLLGVSFQPLSLSSEEYISAFVPYYNK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggatattaggcaagaagtagtgaaaatggcacaagaagcggagaaatatggacttatc
aaatacaaatcaggtaatttcagtgtgcgggataaatatagcggatatatatatattaca
ccttcttggattccaagagaagagcttacaccagaaataatttcagtattagatgggagt
ggtaaaatactctcgtctgtgtataagccatcagctgaatatttaatgcatgttaaaatt
tatcaaaacaggagtgatgtatttgctatttgccattcccattcattatatgctacgaca
tttgcaattgccaatatagagattccacccgttagtagagaagctgtacattacggcgca
ataacgattcctgtagcagattatgcaccaccggggtcagaggaactggcagataatgta
gtaaaaactttaggacaatacgattgctgcttgttaaggaatcatggtgtagttactgta
ggaaaaaatgcagaagatgctttgattaagcttgtatatgtagaggaaaatgccaaagaa
ttttttaatttaaaattgttaggtgtatcctttcaacctcttagtttgagtagtgaggaa
tatataagtgcttttgtgccttattacaacaaataa

DBGET integrated database retrieval system