KEGG   Thermoanaerobacter wiegelii: Thewi_0219Help
Entry
Thewi_0219        CDS       T01607                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thewi_0219
   00051 Fructose and mannose metabolism
    Thewi_0219
Enzymes [BR:twi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Thewi_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
229982..231010
Genome map
AA seq 342 aa AA seqDB search
MERKLKNSVGIWAFGHTPTRFVGTGYHPKLSNETMEARTERVLKGLGDFIDGYEYHYPNE
INENNVSSIKEILASEGKDIYCIALGHHTNPKYSLGSLVNPFPEIRKEAINIAKDGIDLA
SSVGANFIIWPGGEGYNYPFQTDYERMWNDFIDAIAILTEHANKKGVTIFLEHKNSEPAM
KVAMRSIGMTLYVINKVKERGVDTSNLKVNMDWQHLIMNGENLAEYARLLAMENKLGHQH
ANSGWGTFDDDNMVGALRFMETLELAKELQLIGYGKNGERIGFDLLPYTEDAIEAVKESV
IHWEFIYDLAYKINTERLYEAKRTKDAVKAYKEVYKALGAKF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaattaaaaaacagtgtcggaatatgggcatttggacatacaccaacaaga
tttgtaggcactgggtaccaccccaagctttcaaatgagacaatggaagcaagaacagaa
agagttctcaaaggattaggtgattttattgatggctatgaataccattacccaaatgag
ataaatgaaaataatgtaagcagtataaaagaaatattagctagtgaagggaaagacata
tattgtatagctcttggccatcatacaaatcccaagtattctttaggttctttagtaaat
ccttttcctgaaatacgcaaggaagctataaacattgctaaagatggtatagacttagcg
tcttcagttggtgctaattttataatttggccgggtggtgaaggatataattatcctttt
cagactgattatgaaagaatgtggaatgacttcatagacgcaattgccattcttacagaa
catgcaaataaaaaaggagttactatatttcttgagcataaaaacagtgaacctgccatg
aaagtagctatgagaagcataggtatgacactgtatgttatcaataaagttaaagaaagg
ggagtagatacaagtaatttaaaggtcaacatggattggcaacatcttataatgaatggt
gaaaatttagccgaatatgcaaggctattagctatggaaaataaattaggtcatcagcat
gcaaacagtggatggggaacttttgacgacgataatatggttggtgccttacgatttatg
gagacattagaactggcgaaagaattacaacttattggttatggcaaaaatggcgagaga
ataggctttgaccttttaccctatacagaagatgcaatagaagctgttaaagagagtgtg
attcattgggaatttatttatgatttagcttacaaaataaataccgagcgtctatatgag
gcaaaaagaaccaaggatgctgtaaaagcctacaaagaagtatataaagcacttggggca
aaattttaa

DBGET integrated database retrieval system