KEGG   Thermoanaerobacter wiegelii: Thewi_0230Help
Entry
Thewi_0230        CDS       T01607                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Thewi_0230
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Thewi_0230
Enzymes [BR:twi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Thewi_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
244015..245592
Genome map
AA seq 525 aa AA seqDB search
MKVNDMTLEEKIGQMLMVGFPSPIYDDHIEELTSEYKIGNVILFSRNLKDKVQLQSLCNN
IQMNMIKHTGIPALIAIDQEGGMVTRIYKDATYLPGNMAIAATNNPENAYKIGEIAGKEL
RALGININFAPVLDVNNNPSNPVIGVRSYGENPEKVAEFGINYIKGVQKENVIATAKHFP
GHGDTSVDSHFDLPLVSHNKERLYRIELYPFKKAIENGVEAIMTAHILFLALEKNKLPAT
LSHNILTNILRKELRFNGVIITDCLEMNAIAKYFGTAKAAAMAIKAGADIVLVSHTKKLQ
IEAFSEIKEAVLRGEISIERIDESVERIIQLKEKYKLFENPYPDENKIKTIVGCKEHQEI
AKNISLNSITIVKNENNLLPIKKQKILAVSPETVPISGVDDTLMDKVSFAKAFVQKFGGV
EKTIPVNPDEDLINTIREESKDKEIVVVGAYNASLNEGQVRLVNSLLEVNKNIIVVALRN
PYDLLKFKDVPTYVCAYEYTPLSVESVLEVLSGNYVAKGELPVSL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaatgacatgaccttagaagaaaaaataggtcagatgctgatggttggtttc
ccatcgccgatttatgatgaccatattgaggagctgactagtgagtataaaatcggtaat
gtgattttattttctcgaaatttaaaagataaagtacaacttcaaagtttatgcaacaat
atccaaatgaatatgataaagcatacaggtattccagctttaattgctattgaccaagaa
ggtggaatggttacgagaatttataaagatgccacttacttgccaggtaatatggctata
gcagctacaaacaatcctgaaaatgcatataaaataggggagatagcaggtaaagagctt
agagcattgggcataaatattaattttgctcctgtccttgatgttaataataatccatct
aatcctgtaataggggttaggtcttatggagaaaatccagaaaaagtagcggagttcgga
attaattatataaaaggtgtacaaaaagaaaatgttatagcgacagcgaagcattttcct
ggtcacggggatacttcagtagattctcattttgatttaccattggtgtctcacaataaa
gagcgattatatagaattgagttatatccttttaaaaaagcaatagaaaatggagtggaa
gccataatgacagcccatattctctttttagctcttgagaaaaataaattgcctgcaaca
ttgtcccataatattctcaccaatatactgagaaaggaacttagatttaatggagtaatt
ataactgattgtttggaaatgaatgcaattgcaaaatattttggcacggccaaagcagct
gcgatggccataaaagcaggagcagatatagtccttgtttcccatacgaaaaaactgcag
atagaggcatttagtgaaatcaaagaggcagttttacgaggtgaaatatcaattgaaaga
atagatgaatctgttgaaagaataatccaattaaaagagaaatacaaactttttgaaaat
ccatatccagatgaaaataaaattaaaactattgtggggtgtaaagaacatcaagaaatt
gcaaaaaacataagtttgaatagcatcactattgttaaaaacgaaaataaccttttacca
ataaagaaacaaaaaatattggcagtttctcctgaaacggtcccaatttcaggtgtggat
gatactttaatggataaagtatcttttgcaaaagcttttgtacaaaaatttgggggggtt
gaaaaaactattcctgtaaatcctgatgaagaccttataaatactatcagagaagagtct
aaagataaagaaattgttgtagtaggcgcttataatgctagcttaaatgaaggccaagta
aggcttgtaaactcattgttggaagtgaataaaaatatcattgttgttgccttaagaaat
ccatatgatttattaaaatttaaagatgtgcctacatatgtttgtgcttatgaatatact
ccactttctgtagaaagtgtgctagaggttttaagtggtaattatgtggcaaaaggagaa
ttgccagtttctttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system