KEGG   Thermoanaerobacter wiegelii: Thewi_0283Help
Entry
Thewi_0283        CDS       T01607                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thewi_0283
   01230 Biosynthesis of amino acids
    Thewi_0283
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_0283
   00030 Pentose phosphate pathway
    Thewi_0283
   00051 Fructose and mannose metabolism
    Thewi_0283
  Energy metabolism
   00680 Methane metabolism
    Thewi_0283
Enzymes [BR:twi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thewi_0283
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thewi_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
305040..306128
Genome map
AA seq 362 aa AA seqDB search
MPKITLTVIKADVGGFVGHTDVHPELLEIAKKHLKEKGKMLIDFHVTRVGDDIELIMTHR
EGIDNEEVHKLAWDALWSCGEKAKELKLYGAGQDLLKDSFSGNIKGLGPGVAEMEFEERK
SEPVIIFMADKTEPGAWNLPLYKMFADPFNTVGLVIDPNMHQGFRFEVYDMIEHKKIIFD
TPQDIYDMLVFIGATGRYSIRKVYTKNNEIAAVSSTQRMNFMAGKYIGKDDPVLIVRCQN
GLPAVGEALEPFANPYLVAGWMRGSHNGPMIPVSLENAVPTRFDGPPRVCALGFQLAEGK
LIGPQDFFKDVAFDNARKKALEIADYIRKMGPFEPHRLPLEELEYTTLPHVVEKLRERWE
KE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaataacattaacagtaattaaagcagatgttggtggctttgtagggcataca
gacgtacatcctgaacttcttgaaatcgctaagaaacatttaaaagaaaaagggaaaatg
ctcattgactttcatgtgactagagtaggagatgacattgaacttataatgactcataga
gaaggaatagataacgaagaagttcataaacttgcatgggatgcactttggtcttgtggt
gagaaagctaaagaacttaaattgtacggtgcaggacaagatttgttgaaagattcattt
tcaggcaatataaaggggttaggaccgggagttgcagagatggaatttgaagaaagaaaa
agtgaacctgtcataatctttatggctgacaaaacagagcccggagcgtggaatttacca
ctttataagatgtttgcggaccctttcaatacagtaggactggtaattgaccctaatatg
caccagggatttagatttgaagtttacgatatgattgaacacaaaaagataatatttgat
actccgcaggatatctatgatatgttggtattcattggagctacagggagatactctata
cgaaaagtgtatacaaaaaacaatgaaattgcagcagtgtcatctactcaaaggatgaat
tttatggcggggaaatatataggaaaggatgaccctgtacttattgtgaggtgccaaaat
ggtcttccagcagtaggtgaagcattggaaccttttgctaatccctatcttgttgctggc
tggatgagggggtctcataatgggcctatgatacctgtttcattggaaaacgctgtgcct
accagatttgatgggccaccaagagtatgcgcccttggctttcaattagcagagggtaag
cttattggtccgcaggatttctttaaagatgtcgcttttgataatgcaaggaaaaaagcg
ttagaaatagccgattacataagaaagatgggaccctttgagcctcacaggttgcctttg
gaagaattagaatacactacccttcctcatgttgttgaaaaacttcgagagagatgggag
aaagaatga

DBGET integrated database retrieval system