KEGG   Thermoanaerobacter wiegelii: Thewi_0370Help
Entry
Thewi_0370        CDS       T01607                                 

Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thewi_0370
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Thewi_0370
Enzymes [BR:twi01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Thewi_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
396942..397817
Genome map
AA seq 291 aa AA seqDB search
MFELKGVIPALVTPMTKDYKLDLKGLCELIDFQIKSGSDSIIVGGSTGEYNLLTEDERRE
IIRVAVEYAAGRIPVIAGTGSNSTDATIRLSKYAEEVGADAVLVINPYYPNPGQNGLYEH
FKELAKSVNIPIIIYNWPAGTNIDISIETLEKLSEFDNIIGIKDTAPLEHTMLLIAHFGK
RYAITTGLEIFFLSAIQLGATGGIGVAQNIIPRQMVELYKMAMIEPEAAKELHYRLLPLY
EVLFIEPNPVPIKTALNIMGMPAGPCRPPLQPMRQENIEKLKTVLKELGLC
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaactgaagggtgtaatacctgccttggttactccaatgacgaaggattataaa
ttggatttaaaaggattgtgtgaattgatagattttcaaataaaatcagggtctgacagc
ataatagttggtggtagtacaggtgaatataatcttttgactgaggatgaacgtcgcgag
ataataagagtagcagttgagtatgctgcggggagaattcctgttatagcagggacgggt
agtaacagcacagatgctactattcgattatcaaagtatgcagaagaagttggggcagat
gcagtattagtaataaatccgtattatccaaaccctggacagaatggattgtatgaacac
tttaaagaattagcaaaatccgtaaatatacctattatcatctataattggcccgcaggt
acaaatattgatatatcaatagaaacacttgaaaaactcagcgaatttgacaatattata
ggcataaaagatacagctccgctcgaacatacaatgttacttatagcacattttgggaaa
aggtatgctattacaacaggccttgaaatatttttcttgtctgctatacaattgggggca
actggtgggataggggttgcgcaaaatataattccacggcaaatggtagaactttataaa
atggctatgatcgagccagaagctgcaaaagagctacattatcgtttattaccgttatat
gaagttttgtttattgagcctaatcccgtgcctattaagacggcattaaatattatgggt
atgccagctggtccttgcagaccccctcttcagccaatgcgtcaggaaaatatagaaaaa
cttaagactgttctaaaagagctgggtctttgctaa

DBGET integrated database retrieval system