KEGG   Thermoanaerobacter wiegelii: Thewi_0373Help
Entry
Thewi_0373        CDS       T01607                                 

Definition
(GenBank) phosphotransferase system PTS lactose/cellobiose-specific IIA subunit
  KO
K02759  
PTS system, cellobiose-specific IIA component [EC:2.7.1.196 2.7.1.205]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Starch and sucrose metabolism
Phosphotransferase system (PTS)
Module
PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thewi_0373
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Thewi_0373
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     Thewi_0373
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     Thewi_0373
Transporters [BR:twi02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    Thewi_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
400055..400384
Genome map
AA seq 109 aa AA seqDB search
MSSEEIIFQMILHGGNARTEAYEALKYAKVGDFETAQRHIEAASEELHKAHQVQADIIQK
EAAGGESKITLLMVHAQDHVMTAMAEKNLIERMVDLYKLIYENMKKNTP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagaagaaattatttttcaaatgatattacatggaggtaatgctagaacagag
gcatatgaggcattaaaatatgctaaagttggagattttgagacagcgcaacgtcatatt
gaggctgcatctgaggaactacataaagcacatcaagtccaagcagatataatccaaaaa
gaagcagcaggcggagagagtaaaataacattattaatggttcatgcgcaggatcatgta
atgacagctatggcggaaaaaaatcttattgaacggatggttgatttgtataaattaatt
tatgaaaatatgaaaaaaaacacaccataa

DBGET integrated database retrieval system