KEGG   Thermoanaerobacter wiegelii: Thewi_0375Help
Entry
Thewi_0375        CDS       T01607                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thewi_0375
Enzymes [BR:twi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Thewi_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
400912..402726
Genome map
AA seq 604 aa AA seqDB search
MYAYMNKILYIDLTQKKYYFKELQQEIVELFIGGKGLGLKLLYDELPPKLDPFNEKNLLI
FVSGPLTGTLAPSMRGCVISKSPLNNMFDDSYFGGHFIQEVKYAGYDAIVISGKSETPVF
ILIEDDNVKILEADYLWGLDTYETYDVLKGKLGKDVKIACIGPAGENLVKYALIDCDPHR
QAGRGGLGAVMGSKKLKAIAVRGSKGIKIKEPKLFFEEVKKAHEFLKESTKPLAKYSTLI
NIPFSNEMGFFPVRNYSSGSFEKRSSINYDQHDKRVWLRDSACAACPIHCSKLGVIRRGA
YKGSLCDNVEYETAGLLGGNIGISNVEDLNYLNLLCDKLGLDTISAGGVVGFTIEAYKNG
LISKEDLGTDIDFGNTKAVAFLLNQIAYRKGIGNILAEGVLKASSIIGGGAEKLAVTIQG
YEVPAWGPRGSEGMGLAYLTGDRGGCHQRAFPIAYEVEGVWQGQPVEDGKSINLKPEIVI
WEQNLLAALYSLTICEIARGGITVNQYLDMFKYATGRDIDQDEFFRIGERIWNLARLFNI
REGWKQNYSAMPSRFKEPLPDGKMKGHYFEENKLSQMMLRYNQLRGWDENGIPTNEKLKE
LRLI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcttatatgaataaaattttatacattgacttaactcaaaaaaaatattatttt
aaagaacttcaacaggagatagtagaattatttataggtgggaaagggttaggtttgaaa
ttattatatgatgaactacctcctaaattagatccttttaacgaaaaaaacctcttgatt
tttgtaagtggacctcttaccgggaccttagctcccagcatgagaggttgcgttatttca
aaatctcctctcaataatatgtttgatgattcttattttggagggcattttatccaggaa
gtcaaatatgctggttatgacgcaattgtaataagcggaaagtctgagacacctgttttt
attcttattgaagacgataatgtaaaaatattagaagcagattatttatggggacttgac
acttatgaaacttatgatgtattaaaaggcaaattaggtaaagacgtaaaaattgcttgt
attggccctgcgggagagaacctagtgaaatatgcactaattgattgtgatccacatagg
caagcgggtaggggtggattaggagcagttatgggttcaaaaaaacttaaggccatagcc
gttagaggtagtaaaggtataaaaattaaagaaccaaaattattctttgaagaagttaaa
aaagctcatgagtttttaaaagagagtacaaaacccttggcaaaatattcaactttgata
aatatccctttttcaaatgaaatgggtttttttcctgtaagaaattactcatcagggtct
tttgaaaagagaagtagcataaattatgaccaacatgataagagagtttggttacgagat
agtgcctgtgcggcatgtcctattcattgtagcaagttaggagtgatcagaaggggagcg
tataaaggtagcttgtgtgacaatgtagaatatgaaacagcaggccttttagggggtaac
ataggtatttcaaatgtagaagacttgaactaccttaatcttctatgtgataaattaggt
ttagatacaattagcgcaggtggagtagttggttttacaatagaggcatataaaaatgga
ttaatttcaaaagaagatttgggcactgacatagactttggaaatacaaaagctgttgct
tttttactcaaccagatagcttatcgtaaaggtataggcaatattttggcagaaggggta
ttaaaagcatcatccattataggaggaggagctgagaaattagctgtaactattcaggga
tatgaggttccagcgtggggtccaagaggttcagaaggaatggggttagcctacctgaca
ggtgaccgaggaggatgtcatcagagagcttttcccattgcttatgaggtggaaggggta
tggcaggggcaacctgttgaggacggtaaaagtattaatttaaaacctgaaatagttata
tgggagcaaaatttgttggcggcactgtattcactaacgatatgtgaaattgcaagggga
ggtataacagttaatcaatacctagatatgtttaaatatgcaacaggaagagatatagac
caagatgaattttttagaattggagaacgtatatggaatttagctagattatttaatata
agggaaggttggaaacaaaattattcggctatgccgagtcgatttaaggaacctttgcct
gacgggaaaatgaaaggtcattattttgaagaaaacaaattatcgcaaatgatgttacga
tacaaccagcttagaggatgggacgaaaatgggattcccaccaacgaaaaacttaaagaa
ttaaggttaatataa

DBGET integrated database retrieval system