KEGG   Thermoanaerobacter wiegelii: Thewi_0376Help
Entry
Thewi_0376        CDS       T01607                                 

Definition
(GenBank) Integrase catalytic region
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
403044..404303
Genome map
AA seq 419 aa AA seqDB search
MLGSGSIIMIHELRAKGKSIRAISRETGHSRNTIRKYLRTEGIPERKPRPKRGSKLDPYK
DTIHEYINMGIFNCEVIYERIKEEGYTGGKTILRDYVRQFRPSKHIQAVCRYETKPGEQA
QVDWGEYNYIDQETGEVRKLYLFVMVLGYSRAMYVEFTNRCDVHTFNRCLIHGFEYFGGV
TDVVLSDRMRTVIIGTDANKKPLWNPVFEDLAATLGFVPKVCKARRPQTKGKVESGIDFV
KDNFLPGRRFLDYGDLNRQAVEWCDKKNRRVHGTTGERPIDRLKRENLKPLPPLDKYQKF
LEEPRKVHKDGLLSYDGVRYGVPWQYSGKEVVVREKNGKIEVLYDSKIIAVHDKHYRSGS
PVFLKDQYKGLKAAEGLLYPRPKAIKLFSLEVERRSLSLYESLAEVTGYDRSGESQTTS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgctagggagtgggtctattatcatgatacatgaactcagggcaaaaggcaagagtatt
cgtgcaatttcacgagaaacagggcattctcgaaacacaataagaaagtatctcagaaca
gagggaattcccgaaagaaaacctcgtcctaagaggggctcaaaacttgacccttacaaa
gatactattcatgagtacattaacatgggaatatttaactgtgaagttatttacgaaaga
ataaaagaagaaggttacactggaggaaagactattttaagagactatgtaaggcagttt
agaccttcaaagcatattcaggctgtatgccgctatgagacaaagcctggagaacaagcc
caggttgactggggtgaatacaattacattgatcaggaaacaggagaagtaagaaaactc
tatctctttgtcatggtacttggttattcaagagcaatgtatgttgaattcacaaatcgc
tgtgatgttcacactttcaaccgctgccttatccatggttttgaatattttggtggagta
actgacgttgtacttagtgacagaatgagaactgtaatcataggtacagatgcaaacaag
aaacctttatggaatccagtatttgaggaccttgcagcaactttgggatttgtacctaaa
gtctgcaaagctagacgtccacagacaaaaggcaaagtagaaagtggaatagactttgtc
aaggacaattttctacccgggagaagatttttagattatggtgacttaaatcgtcaggca
gtagagtggtgtgataagaaaaacagaagggtacatggtactacaggagaaagaccaatt
gacagactaaagagggaaaacttaaagcctttgcctccattagataaatatcaaaaattt
ctggaggaaccaaggaaggtacataaagatggtctcttaagttatgatggtgtaaggtat
ggagtaccatggcagtacagcgggaaagaggtagttgtaagggagaaaaatggcaaaatt
gaagttctctatgatagcaagataatagcagtacatgacaaacattatcgttcaggaagt
ccagtttttctcaaagaccagtacaaaggcttaaaagcagcagaaggtctgctttatccc
agaccaaaagcaatcaagttattttcactagaggttgagagacgttcccttagcctttat
gaaagtctagcggaggtgacaggatatgatagatctggagaaagccagactacatcttga

DBGET integrated database retrieval system