KEGG   Thermoanaerobacter wiegelii: Thewi_0378Help
Entry
Thewi_0378        CDS       T01607                                 

Definition
(GenBank) thiamineS protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
405260..405481
Genome map
AA seq 73 aa AA seqDB search
MIKVKVFGTFKEGREKEINFDYFEGITGRFIINKLNIKEEAVAIFLVNGLDGKLDDPLSD
GDVISLFPPVGGG
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaagtaaaggtatttggaacctttaaagaggggagagaaaaggaaataaatttt
gattattttgagggaattacaggaagatttataataaacaaacttaacataaaagaagaa
gctgtagcaatatttttagtaaatggacttgatgggaagcttgatgatcctcttagtgat
ggagatgtgatttccctttttccacctgttggtggtggttga

DBGET integrated database retrieval system