KEGG   Thermoanaerobacter wiegelii: Thewi_0383Help
Entry
Thewi_0383        CDS       T01607                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K05773  
tungstate transport system permease protein
Organism
twi  Thermoanaerobacter wiegelii
Pathway
ABC transporters
Module
Tungstate transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Thewi_0383
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Tungstate transporter [MD:M00186] [OT]
    Thewi_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
409216..409914
Genome map
AA seq 232 aa AA seqDB search
MELIWEGLKGAFKFLVHGDPEIREITLLSLRIAAWAIGISSVIGLPLGIALGVSTFRGRD
FLLTLANTGMGLPPTVVGLWVAIVLWRTGPLGGLKLIYTPTAIIIAEVILTVPIIIALVA
AAASDKKAKLHDFFLSLGLNPLQYMWLLLREIRSSVLTAIIAGFGRAISEVGAAMMVGGN
IAGETRTLTTAIVLEVSKGEFDRALAISFVLLALSFSITAFITHLQYQQNLK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttatctgggaaggcctgaaaggagcattcaagtttcttgttcatggggatcca
gaaatcagagaaattactcttctttctcttaggattgctgcgtgggctatagggataagt
tcagtcattggccttccacttgggattgcacttggagtaagcacgttccgtggcagggat
tttcttctgactttagccaataccggcatgggacttccaccgacagttgtggggctttgg
gtagctattgtgctatggcgtaccggccctttaggaggattaaagctgatttatactcct
actgccatcatcattgctgaagtaattcttaccgtgcctattattatagctttggtagct
gcagctgcgtcggataaaaaagctaaattacacgatttttttctttctttagggttgaac
cctcttcaatatatgtggcttttacttcgggaaattcgtagctcagttttaacagcaatc
attgccggttttggacgtgcaatttcggaggtaggagcagcaatgatggtaggagggaac
atcgctggggaaacccgcacgcttaccaccgctattgttcttgaagtatctaagggtgag
tttgaccgcgcgttagcgataagttttgtacttcttgccttatcgttttctattactgcc
tttattacccaccttcagtatcaacaaaacttaaagtag

DBGET integrated database retrieval system