KEGG   Thermoanaerobacter wiegelii: Thewi_0384Help
Entry
Thewi_0384        CDS       T01607                                 

Definition
(GenBank) ABC transporter related protein
  KO
K06857  
tungstate transport system ATP-binding protein [EC:3.6.3.55]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
ABC transporters
Module
Tungstate transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Thewi_0384
Enzymes [BR:twi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.55  tungstate-importing ATPase
     Thewi_0384
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Tungstate transporter [MD:M00186] [OT]
    Thewi_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
409965..410726
Genome map
AA seq 253 aa AA seqDB search
MNYMFERKATDFRDIENQTPVIIAEDISVRRNERFILRNISLVLHQGERLGLAGPNGSGK
STLLKVLSLLIPPSSGRLTVLGFMGDGRSSVTVRRKMSIVFQQPTTLTGSVLQNVSIPLR
MRGLSAREATKRAYEWLKCFDLEKLAFQRIHTLSGGELARLQLARAFAMEPEILFLDEPF
AAVDATSRSPLKVLLREILAKNKVSLLLISHDFRDLLDLTERTLVLLDGHIVAQGKTQTL
RIQSPLVREIFPE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattatatgtttgaacgcaaagctaccgattttcgggatatagagaatcaaacgccg
gttattatagccgaagatattagtgtacggcgcaatgaacgctttatcctgcgaaacata
agcctcgttttgcatcaaggggaacgtttgggacttgcgggtcccaatggttcaggaaaa
agtacgctccttaaagtcttatccttactaattccaccgtcttctgggaggcttacagtt
cttggctttatgggagacgggcggtcttcagtgactgttcgccgaaagatgtctatcgtc
tttcaacaaccgacgacgctcacagggagtgttttgcaaaacgtgagtattcccctgcgc
atgcgaggactttctgcccgagaagcaaccaagcgggcatatgagtggcttaagtgtttt
gatttagaaaagcttgcttttcagcggatacatacgctttctgggggagaacttgcacgt
cttcagctagcaagggcgtttgctatggaaccggaaattttgttccttgatgaacctttt
gcagcagtggatgctacttcacgcagtccactaaaggtccttcttcgggagattctggca
aaaaacaaggtttcactgcttcttattagtcatgattttcgtgaccttctcgatcttact
gagcgcacgctggttcttttggatgggcacattgttgcacaaggtaaaacccaaactttg
cgcatacaatctccactcgtgcgtgagatttttccggagtaa

DBGET integrated database retrieval system