KEGG   Thermoanaerobacter wiegelii: Thewi_0386Help
Entry
Thewi_0386        CDS       T01607                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thewi_0386
Enzymes [BR:twi01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     Thewi_0386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
411407..412630
Genome map
AA seq 407 aa AA seqDB search
MELLKLVTVKEAKEIIEKNISFKPGIEKISILNSLGRILAEDIYAPENVPDFRKSTVDGY
AVISSDVFGASESLPAILKLVGEVKIGTEPTLDIMPGECMYVPTGGMLPKSADTVVMIEY
TEKLDDETILVNKPAAPFQNIIEIGEDVKKGELILKKGTKLRPYEIGVLSSLGILEVEVY
KKVKVGIISTGDEIVDPKEKINKGQVRDINSYLLYSLCLEEGAEPVLYGIVKDDYEKLRE
KLQAAISECDLVLMSGGSSAGNKDETLRVIGSFENSNIFIHGVAIRPGKPTIVGKVGDKF
IFGLPGHPLACAAIFKTLVIHYLDRIKNFEREEYPVECRFAVNYHKAEGRAEFLPISIKE
AEGKLIAYPTYYESGLISRFAKSFGYVYIEKELEGISEGQIVKVYKF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttaaaacttgttacagtaaaagaggcaaaggagataatagaaaaaaatatt
agttttaaacctggcatagagaaaataagtattttaaattcgttaggaaggattttagca
gaagacatatatgcaccggaaaatgttcccgattttagaaaatcaaccgttgatggatat
gctgtgatttcgagtgatgtttttggagcgagtgagagtttacctgcaattttaaagctt
gttggagaagtcaagataggaacggaaccaaccctggatataatgccaggagagtgcatg
tatgttccaacagggggtatgcttcctaaaagtgccgatactgttgttatgattgaatac
acagaaaaacttgatgatgaaactattttagtcaataaaccagctgcgccctttcaaaac
ataattgaaattggagaagatgtaaaaaaaggtgaactcattttaaaaaaaggcacaaaa
ttgagaccctacgagataggggttttatcaagtcttggaatattagaggtggaggtttat
aaaaaagtaaaggttggaattatttccacaggcgatgagatagtggaccctaaggagaaa
attaataaaggacaggtcagggacataaatagctatctgttatactctctgtgtcttgaa
gaaggagcagagcctgttctatacggcattgttaaagatgattatgaaaaattaagagag
aaattgcaagcggcaataagtgaatgcgatttagttttgatgtcgggtggcagttcagcc
ggcaacaaagatgaaactctcagggttataggttcatttgaaaattcgaatatttttatt
catggagttgctatacgacctgggaaacctacgattgttggaaaagtaggggataaattc
atatttggacttccggggcatccactggcctgtgcggcaatatttaaaacccttgttatt
cactatttggacaggataaagaattttgaaagagaagaatatccggttgagtgcaggttt
gccgtaaactatcataaggctgagggtagagcagaatttttacctattagtataaaagaa
gcggaaggaaaattaattgcgtatcccacttattatgaatcagggcttatatctcgtttt
gcaaaatcctttggatatgtttacattgaaaaagaattagagggcatatctgaaggacaa
atagttaaagtttataaattttag

DBGET integrated database retrieval system