KEGG   Thermoanaerobacter wiegelii: Thewi_0393Help
Entry
Thewi_0393        CDS       T01607                                 

Definition
(GenBank) PTS system, mannitol-specific IIC subunit
  KO
K02799  
PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  
PTS system, mannitol-specific IIC component
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Fructose and mannose metabolism
Phosphotransferase system (PTS)
Module
PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thewi_0393
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Thewi_0393
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     Thewi_0393
Transporters [BR:twi02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    Thewi_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
417906..419351
Genome map
AA seq 481 aa AA seqDB search
MQNTNALITGGGSVKAKLQRLGGFLAGMVIPNIGAFIAWGLITAFFIPTGWIPNEHLAKL
VGPMITYLLPILIGYTGGKLVYDVRGGVVGAIATAGIIIGSSIPMFLGAMLMGPLGGYVI
KKFDELVEGKIPAGFEMLVNNFSAGILGGLLAILAFLFIEPVVNGISVGLGAAAQWVTNK
GLLPLIAIFIEPGKILFLNNAINHGILAPLGVAQVKELGKSIFFLLETNPGPGLGVLLAY
WFFGKGDAKQSAPGAIIIHFFGGIHEIYFPYVLMNPSLLLAVIGGGMAADATFVLTKAGL
VATPSPGSIFAEIAMSPKGGLLPVLAGITVGAVVSFLIASVIVKRASEESMSAESMTFAR
SIVSGLKAQSKGQKVEEIKPNVQKIDGMPKMIVFACDAGMGSSAMGETILKKKLKEAGLN
ITVKHSAVNQIPKEADIVFTQENLAERASQVVPNAKIVTVKNFLDNTAYDEFVKSLAENN
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacactaatgctctcataactggtggcggaagtgtaaaggcgaagttgcaaagg
cttggtggcttcttggctggcatggtaatacctaatattggtgctttcatagcatgggga
cttattactgctttctttattccgacagggtggattccaaatgaacatttggctaaactt
gttggacctatgataacttatcttttaccaattttaatcggttatacaggtggaaaactt
gtatacgatgtaagaggtggagtagttggtgctattgcaacagcaggtattataatcggt
tcatctataccgatgtttcttggtgccatgctgatgggtcctttaggaggttatgtcatt
aaaaaatttgacgagcttgtagagggaaaaatcccagcaggttttgaaatgcttgtcaac
aatttttcagcaggtattttaggtggtttattagcaattttagcatttcttttcattgaa
ccagtggtaaatggaatttcagtaggattaggtgcagcagctcaatgggtgacaaacaaa
ggcttattacctttaatagcgatttttatagaaccgggtaaaattttatttttaaataat
gctattaaccacggtatattggctcctcttggagtagcacaagttaaagaacttggaaag
tcaatattcttcttgctggaaacaaatccaggtccgggattgggagttttactggcatac
tggttctttggaaaaggtgatgcaaaacaatcagctccaggtgctatcataatacacttc
tttggcggaatacatgaaatatatttcccctatgttttaatgaatccatcactgcttttg
gcagttataggcggtggaatggctgcagacgcgacatttgttttgacaaaagcaggtttg
gtagctacgccttcacctggtagtatatttgcagagatagctatgtcaccaaaaggcgga
ttacttcctgtacttgcaggtattacagttggagctgttgtttccttcctcatagcttct
gtcattgtaaaaagggcaagcgaagaaagcatgagtgccgaaagcatgacttttgctcgc
tcgatcgttagtggacttaaagcgcaaagcaaaggacaaaaagttgaagaaataaagcca
aatgtacaaaaaatagatggcatgcctaaaatgattgtttttgcttgcgatgctggtatg
ggttcgtcagcaatgggagaaactattttaaagaagaagttaaaggaagcaggacttaat
attacagttaagcattcagctgtaaatcaaataccaaaagaagcggatattgtatttacc
caagaaaatctcgcagaaagggcttctcaagttgtaccaaatgcgaaaatcgttacagta
aaaaactttttagataatactgcttacgatgaatttgtaaaaagtcttgcggaaaataat
aaatag

DBGET integrated database retrieval system