KEGG   Thermoanaerobacter wiegelii: Thewi_0398Help
Entry
Thewi_0398        CDS       T01607                                 

Definition
(GenBank) TIM-barrel protein, nifR3 family
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
427206..428171
Genome map
AA seq 321 aa AA seqDB search
MKIGDVVLKNNVFLSPMAGVTDKPFRLICQEMGCGLAYTEMVSAKGLYYGSENTKVLTDI
DEEEKVALQIFGSDPDIMGEIARRLNDSKALILDINMGCPTPKIVKNGDGAALMLKPELA
EKVMESVVKASNKPVTVKIRKGWDDNHVNAVEIAQIAEKVGVKAVAVHGRTREQFYSGKA
DWSIIKKVKESVKIPVMGNGDVFTPEDAKRMLEETGCDAILIGRGAQGNPWIFKRTVHFL
NTGELLPEPTIQEKIEVIIRHLEMMIEYKGERTGILEMRKHIAWYLKGLYGSAKLREAVF
KMEKYEQIKEFLLNIAKTYAD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataggcgatgtagttttaaaaaataacgtatttttatctcctatggcaggggtt
acagataagccttttagattgatttgccaagaaatgggttgtggccttgcatacacagaa
atggttagtgccaaaggcctttattatggcagtgaaaatacaaaagtgttgacagatatt
gatgaggaagagaaggtggctcttcaaatatttggttctgatccagatattatgggggag
atagcaagaaggctaaatgatagcaaagctttaattctcgatataaacatgggatgtcct
acccctaaaatagttaaaaatggtgatggagcggcacttatgctgaaaccagaattagca
gaaaaagtaatggaatctgttgtgaaagcatcaaataaacctgtgacagttaaaataaga
aaagggtgggatgataatcacgtaaatgctgtggaaatagcacaaattgctgaaaaggtt
ggcgttaaagcagtagcagtacatggaaggacgagagaacaattttattctggaaaagct
gactggagtataataaaaaaagttaaagaaagtgtaaaaatacctgttatgggcaatggc
gatgtatttacaccagaagatgcaaaaagaatgttggaggaaacgggatgcgatgcaatt
ttaataggacgaggggcgcagggtaatccctggatatttaaaagaactgtacatttttta
aataccggagaattacttcccgagccgacaatacaagaaaaaatagaagtgattatcagg
catttggaaatgatgatagaatacaaaggtgaacgtacaggtattcttgaaatgagaaaa
catattgcttggtatttaaagggattatatggcagcgccaaactcagggaagcagtattt
aaaatggaaaaatatgagcaaataaaagagtttttattaaatatagcaaagacctatgca
gattga

DBGET integrated database retrieval system