KEGG   Thermoanaerobacter wiegelii: Thewi_0399Help
Entry
Thewi_0399        CDS       T01607                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  
uncharacterized protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
428445..429206
Genome map
AA seq 253 aa AA seqDB search
MSIEYIVALCGIGFAAAFIDSIAGGGGIISLPGLLVLGVPPAFALGTNKFAASCASFTSS
LTFIKYRVYDGDLLKYLVFGTLLGAILGVKTVLLLDSSQLRIIIIILMMFVAIYTLFVKN
IGNENKFEGVNKKTIAIGLIISIILGFYDGFFGPGTGSFYIFLFLTLLNYDFKISAGNGK
ILNFVSNITSLIMFALHGKILYSIAIPMALAMILGARLGTKLAIKNGARLIRPILISVTL
LYAVKMIFDITNH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaattgaatatattgtagcactttgcggtataggatttgcagctgcttttattgat
tctatagcgggtggaggcggtataataagccttccagggcttttagtacttggagtacct
ccagcttttgcgcttggaactaacaaatttgctgcttcttgtgcttcttttactagttct
ttaacttttataaagtatagagtgtatgatggagatttgttaaaatacttggtatttggg
actttattaggtgcaattcttggagtcaaaactgtacttttgttagatagctcgcaatta
aggataattataattattctaatgatgtttgttgcaatatataccttgtttgttaaaaat
ataggcaatgaaaacaaatttgaaggcgttaataaaaagactattgcaataggccttata
atttctataattcttggcttttatgatggcttttttggaccgggaacaggttcattttac
atttttttattcttaacacttttgaattatgattttaaaataagtgcaggaaatgggaaa
atactgaattttgtaagcaatataacttcactaattatgtttgcgttacatggtaagata
ttgtattctattgcaattcccatggcgttagcaatgatactgggggcaagattggggaca
aagctggctataaaaaatggagctcggcttataaggcctatattgatttctgtcactttg
ttgtatgcagtgaaaatgatttttgatataacaaatcattaa

DBGET integrated database retrieval system