KEGG   Thermoanaerobacter wiegelii: Thewi_0410Help
Entry
Thewi_0410        CDS       T01607                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K09816  
zinc transport system permease protein
Organism
twi  Thermoanaerobacter wiegelii
Pathway
ABC transporters
Module
Zinc transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Thewi_0410
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    Thewi_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(441942..442736)
Genome map
AA seq 264 aa AA seqDB search
MIDIFSYEFMRRAFIAGSIISIIAPLTGSFLVLRRLSQIGDTLSHVALAGVAAGILLGIN
PTLGSIIVVLLASFGIERLRKTYFRYSEISIAIVMSAGMAIAIILLSLSRGGAANIMNYL
FGSIVSVTNTDVLLISTLGIVVVASIVLLYKELLYITFDEEAAKISGIPVSYINFFFTIL
VALTVALAMRIVGALLVSALMVIPAAASLRIAKSFKQTIFYAILFSFISVFSGIFLSFYL
NLSPGGSIVIISLIIMGLASLKKR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgattgatattttttcctatgaatttatgagaagagcatttatagccggaagcattatt
tcaataattgcacctttaacaggtagctttcttgtgctaagacggctttcacaaatagga
gacaccctttctcacgttgctttagcaggagtggcagcaggtattttacttggaataaat
cctacattaggttccataattgtagtacttttagcttcttttggaatagaaagactgagg
aagacatatttcaggtattcagaaatatcaatagccatagtaatgtctgcaggaatggca
attgccataattcttttgagcttatctcgtggcggcgcagccaacataatgaattatcta
tttggaagtattgtgtctgtaacaaatactgacgtccttttgatttcgactctcggtatt
gttgtagtggcgtcaattgttttgctgtacaaagagttattgtacatcaccttcgatgaa
gaagccgcaaaaatttcagggatacccgtaagctatatcaatttcttctttacaatacta
gtagctttaaccgttgccctcgccatgagaattgtaggtgcgcttttagtctcagcccta
atggtaataccggctgccgcaagtttaagaatcgccaaaagctttaaacagacaatattt
tatgcaatactcttttccttcatatcagttttttcaggaatatttctatccttttactta
aacttatctcccggtggaagtatagttatcatctcacttataataatgggacttgcctct
ttgaagaagaggtaa

DBGET integrated database retrieval system