KEGG   Thermoanaerobacter wiegelii: Thewi_0413Help
Entry
Thewi_0413        CDS       T01607                                 

Definition
(GenBank) ferric uptake regulator, Fur family
  KO
K02076  
Fur family transcriptional regulator, zinc uptake regulator
Organism
twi  Thermoanaerobacter wiegelii
Brite
Transcription factors [BR:twi03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    Thewi_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(444399..444815)
Genome map
AA seq 138 aa AA seqDB search
MHKQEAIKKLKEHNYKLTPQRELILDIMLNQQGYLSVRQIYEKVKEVFPQVSIDTVYRNL
SLLKDINILNETTIGNNIMYVMRKEIHSHTMRCLKCGKIFELDICPLELWINQIKDFEIV
DHKIEIVGYCKDCRSNKN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcataagcaagaggcaataaaaaaattaaaagagcacaattacaaattaactcctcaa
agggaattaatactggatatcatgttaaatcagcaggggtatctctctgtgagacaaatc
tatgaaaaagtaaaagaagtctttcctcaagtaagtattgacacagtttatcgcaatttg
agccttttgaaagatataaatattttaaatgaaacgacaattggcaataatattatgtat
gtaatgcgaaaagaaatacacagtcataccatgagatgtttaaaatgcggcaaaatcttt
gaactagacatatgccctctcgaactttggataaaccagataaaagactttgaaattgta
gaccacaaaatagaaatcgttggttattgcaaagattgcaggagcaataaaaactaa

DBGET integrated database retrieval system