KEGG   Thermoanaerobacter wiegelii: Thewi_0417Help
Entry
Thewi_0417        CDS       T01607                                 

Definition
(GenBank) LemA family protein
  KO
K03744  
LemA protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
448493..449065
Genome map
AA seq 190 aa AA seqDB search
MKNPLIITLIVLAVIAVLVFGTIYGTYNQLVALDENVNSKWSQIDNQLQRRADLIPNLVE
TIKGYAAHEKEIFDSVNKAREKLLSANTVAEKAASNDELNTALGRLLAIAENYPNLKADA
NFRQLSDELAGTENRIAVARMDYNNAVQAYNTKIRSFPTSIIANMFGFKEREYFKTDEAA
KTVPKVDFSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatccgctaattattacattgattgttttggctgtaatagctgtattagtattt
ggaacaatttatggaacttataaccaattagtggcgttagatgaaaatgtaaatagtaaa
tggagtcagattgataatcagcttcaaagaagggctgatttaattcctaatttagtagag
actattaaaggatatgcagcacatgaaaaagagatttttgatagtgtaaataaagcgaga
gaaaaacttttaagtgccaacactgttgctgaaaaagcagcttcaaatgatgaattaaat
acagcattgggaaggcttcttgctattgcagaaaattatcctaatttaaaagctgatgca
aatttcaggcagttaagcgacgaactagcaggaactgaaaacagaatagctgtagcgaga
atggattataacaatgctgttcaagcttataacaccaagataaggtcttttccaacctct
atcatcgccaatatgtttgggtttaaggaaagagaatattttaaaacagatgaagcagca
aagactgtgcctaaagtagatttttccaaataa

DBGET integrated database retrieval system