KEGG   Thermoanaerobacter wiegelii: Thewi_0419Help
Entry
Thewi_0419        CDS       T01607                                 

Definition
(GenBank) sulfite reductase, subunit A
  KO
K16950  
anaerobic sulfite reductase subunit A
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Sulfur metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Thewi_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
450523..451575
Genome map
AA seq 350 aa AA seqDB search
MSYCVNIKRMNEILKELQKEYKVYAPVRFEKRGRYSDTDLIRYAEINSIEDVVYDEKSDF
SPKEVIYPITQALFYFTEYEYMESKVDDKKILIFARPCDINGFRRLDTIFLKNGGTEDIY
YKRLREKVKFILMECKEGGWDSCFCVSMGSNKTDDYSLAVRFGDDKILVEIKDDEFTNLF
ADEREVEFTPKFVTSNPTKVNIPEIDSHELLEKIYELDMWKSYNSRCISCGACTAVCITC
SCFNTLDVIYTENGKVGERRRVQASCMHEDFTTMAGGLSFRKTAGERMRFRTLHKIYDYK
LRFKDEHMCVGCGRCDERCPELISFPATINRLYDEVEKLKKAETTNKDIR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagttattgtgtaaacattaaaaggatgaatgaaatcttaaaagaattgcaaaaagag
tataaggtatatgctcctgtccgctttgaaaagcgtggtcgttattcagacactgatttg
attcgatatgcagaaattaactcaattgaggatgtagtctacgatgagaaatcagatttt
tcaccaaaagaagtgatttatccgattacccaggcgctattctactttaccgaatatgaa
tatatggaaagcaaggtagatgacaaaaagattctgatatttgcacgcccctgtgatata
aatggctttagacgacttgatactatctttctcaaaaacggaggaacagaagatatttac
tacaagcgtttacgggaaaaagtaaagtttattttaatggaatgcaaagaaggaggttgg
gatagttgtttctgcgtctcaatgggctccaataaaaccgacgactacagtttagcagtt
agatttggcgatgataagatattggtagaaataaaagacgatgaatttaccaatttattt
gccgatgaaagagaagtagaatttacccctaaattcgttacctctaacccgacaaaagtt
aacatccctgaaattgatagccatgaattattagaaaaaatttacgaactcgatatgtgg
aaaagttataattcaagatgtataagctgtggagcctgtaccgctgtgtgcataacctgc
agctgttttaacacattagacgtaatatacacagaaaacggaaaagttggtgagaggaga
agggttcaggctagctgtatgcacgaagatttcacgacaatggcaggtggactgagtttc
aggaaaaccgcgggagagcggatgagattcagaactctgcataaaatttatgactataaa
cttcgtttcaaagacgagcacatgtgtgtaggatgcgggcgatgtgatgaaagatgtcct
gaactaatatcttttccggctaccattaatcgcctgtatgatgaagtggaaaaactcaaa
aaagcggagacaacaaataaagatataaggtaa

DBGET integrated database retrieval system