KEGG   Thermoanaerobacter wiegelii: Thewi_0425Help
Entry
Thewi_0425        CDS       T01607                                 

Definition
(GenBank) SUF system FeS assembly protein, NifU family
  KO
K04488  
nitrogen fixation protein NifU and related proteins
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
456075..456488
Genome map
AA seq 137 aa AA seqDB search
MSDLNQLYSEVIMEHYENSPHEKELKDATHKERGYNPLCGDNITLYLKMNGDIIEDASFT
GHGCAISQASTSMMIDLIKGKDKKEALRLVQQFIDMMHKKDVNLDELGDAQVLQGVSDFP
ARVKCALLAWKTLQEIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttgaatcagctttattctgaggttataatggaacattacgaaaactctccc
catgaaaaagaacttaaagatgctacccacaaagaaagaggttacaatcctctttgcggc
gacaatattactctttatttaaaaatgaatggtgacattatagaagatgcttctttcacg
ggccatgggtgtgccataagccaagcctcaacctctatgatgatagaccttataaaaggg
aaagacaaaaaagaagctttaaggcttgtgcaacaatttatagacatgatgcacaaaaaa
gatgtaaatcttgatgaattaggtgatgctcaagtactgcagggagtatctgactttcct
gcccgcgtaaaatgtgcattactggcatggaaaacgctccaggaaattttgtaa

DBGET integrated database retrieval system