KEGG   Thermoanaerobacter wiegelii: Thewi_0427Help
Entry
Thewi_0427        CDS       T01607                                 

Definition
(GenBank) protein of unknown function DUF820
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(457611..458183)
Genome map
AA seq 190 aa AA seqDB search
MPLPEKNKKYTYADYLTWSEEERWEIINGVPYLQAAPTWQHQAVLLELARQFANYLQDKS
CRVFTAPFDLRIPEANEKDEETTNVVQPDIIIICDNSGLKKTGYYGVPELIIEVVSPSTG
QKDKIEKFNLYEKAGVKEYWIVEPDEKVVMVFTLEEGRYGRPQMYSEEDKVKVSIFDNLV
IELKPVFERI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgccattgcccgaaaaaaataaaaaatatacttatgccgactatttaacctggtctgaa
gaagaaagatgggaaattattaatggtgttccctatctacaagcagctccaacatggcaa
catcaagcagtattgttagaactagcaaggcaatttgcaaactatctgcaggataaatct
tgcagagtatttactgctcctttcgatttgcgaataccagaagcaaatgaaaaagatgaa
gaaactaccaatgtagtacagcctgatataatcattatatgtgataattcaggacttaaa
aagacaggttattatggagttccagaattaattatagaagtagtttctccttcaactggt
caaaaagataaaatagaaaagtttaatttatacgaaaaagcaggggtaaaagaatattgg
attgtagaacccgatgaaaaggtggttatggtattcacacttgaagaaggacgttatgga
aggcctcaaatgtattctgaagaggataaagtaaaagttagtatatttgataaccttgta
attgagttaaaacctgtatttgagagaatttaa

DBGET integrated database retrieval system