KEGG   Thermoanaerobacter wiegelii: Thewi_0431Help
Entry
Thewi_0431        CDS       T01607                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02013  
iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Thewi_0431
Enzymes [BR:twi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Thewi_0431
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Thewi_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
461766..462566
Genome map
AA seq 266 aa AA seqDB search
MAILQVDNLHFSYEEKEVLKGIDFTINKNMVLGIIGANGSGKTTLLKNISGYLKPAAGDV
FILGKNIKDFTIKEKAKYIGYVPQDIVYDFEFSCYDMVMMGRIPYLKRFQLERKEDRDIV
RECMEITNTWQFKDKSIKELSGGERQRVYIARALAQKARILLMDEPVSHLDIKYQVEILS
LVKDLSLKGILVIVVLHDINLASQFCDEIFIMKEGKIIASGSPGNVLTLNNIKSAFSIDV
EVFENPITHTPYVIPSLNGKEQLKVV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggctattttacaggtggataatttgcacttttcttatgaagaaaaggaagttttaaaa
ggaatagattttaccataaacaaaaatatggttttaggaataataggagctaatggcagt
ggtaagactactcttttaaaaaatatatcaggctatttaaagccagcagctggggatgtc
tttatattagggaaaaatatcaaagactttactataaaagaaaaggcaaaatatataggg
tatgtgcctcaagatatagtttacgactttgaatttagctgttatgacatggtaatgatg
ggaagaattccttatcttaaaaggtttcagttggagagaaaagaagacagagatattgta
agagagtgtatggaaattacaaatacatggcagtttaaagacaaaagtataaaagagtta
agtggcggtgaaagacaaagggtgtatatagcgagggcattagcacaaaaagctcgaatt
ttactcatggatgagccagtttctcaccttgatataaaataccaagttgaaatactgtct
cttgtaaaagatttatccttaaaagggatacttgtaattgttgtgcttcacgatattaac
ctcgcttcacagttttgtgatgagattttcataatgaaagaaggcaaaataatagcatct
gggtctcccggaaatgttttaacattgaacaacataaaatcagccttttcaatagatgtg
gaagtgtttgaaaatcccatcacccatactccttacgtcattccatcgctaaatggaaag
gagcaactcaaagttgtgtaa

DBGET integrated database retrieval system