KEGG   Thermoanaerobacter wiegelii: Thewi_0435Help
Entry
Thewi_0435        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECF_trnsprt ECF-ribofla_trS
Motif
Other DBs
NCBI-ProteinID: AEM77920
JGI: Thewi_0435
UniProt: G2MW32
Position
466401..466886
Genome map
AA seq 161 aa AA seqDB search
MKEKANALKNVKTLTLVAMLIALSAVGALIKVFNTVAFDSMPGYFAALYLGGWYGALVIS
LGHMLTAITSGFPLGLTNHIYIAVQMALYAYLFKFFYRKFNIYIAVIAATILNGPVATLL
FVPIFGWGFFAAWVLPLTIASFANVFLAALVYKAIPKRSRE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaaaagcaaatgcattaaaaaatgttaaaactcttactcttgttgctatgctt
atagccttaagtgcagtaggtgctctcataaaagtttttaacacagttgctttcgattca
atgccaggatactttgccgcattataccttggaggttggtatggagcccttgtgataagt
ttagggcatatgcttacagcaattacttctggatttcctttagggcttacaaatcacata
tacatagcagtgcaaatggcattatatgcctatttgtttaaatttttttatcgaaaattt
aacatctatattgcagtaatcgctgctacgatattaaatggtcctgttgcaacccttttg
tttgtgcccatattcggatggggattttttgcggcatgggtacttcccctaacaattgcg
tcatttgcaaatgtatttcttgcagcattggtttacaaagcgatacctaaaaggagtaga
gaataa

DBGET integrated database retrieval system