KEGG   Thermoanaerobacter wiegelii: Thewi_0439Help
Entry
Thewi_0439        CDS       T01607                                 

Definition
(GenBank) Cobalamin synthase
  KO
K02233  
adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thewi_0439
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     Thewi_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
469307..470059
Genome map
AA seq 250 aa AA seqDB search
MEEIKRLVLAMQFMTRLPIPIEIDVEKREFYRIASYFPIVGIVIGGILSLLYIALKDFFS
REIVMTFIVAFSYILTGAMHIDGLADTFDGLFSNKDKSKMLEIMRDSRLGTNGVLAAIFI
VVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMISKSARGGEGLGGLMLGKVGIREF
AIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRIGGMTGDTLGAVNELAELT
ALICFVSVSL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattaaaagattggtacttgcgatgcaatttatgacacgccttcccatacca
atagaaattgatgttgaaaaaagagagttttatagaatagcatcttattttccgatagtc
ggaattgttataggaggtatcctttcactcttgtatattgctttaaaggatttcttttcc
cgggaaattgtaatgacttttattgtagctttttcttatattttaacaggagcaatgcat
attgacgggcttgcagatacttttgatggcctttttagcaataaggataaaagtaaaatg
ctggagataatgagagactcgagacttggcactaatggagtcttagctgcaatttttata
gttgttttaaaaatattatttctcaccaatatacacgaaaatattactttaacagcactt
ttaattaccccaattattgggagattgtcaattgtgttttctatgatgataagtaaatct
gcaagaggtggagaaggccttggaggactcatgctgggtaaagtagggataagggaattt
gcaattgcttttgttatttcaattgctacaagctattttatactgcctttagcggttttt
gtaaaaatacttactatatcgctttttgttacttatattgtatcaaaatatatttcgctg
agaataggtggtatgactggggatactttaggtgcagtaaatgaattggcagagcttact
gcactcatttgctttgtaagtgtgtcattataa

DBGET integrated database retrieval system