KEGG   Thermoanaerobacter wiegelii: Thewi_0446Help
Entry
Thewi_0446        CDS       T01607                                 

Definition
(GenBank) Porphobilinogen deaminase
  KO
K01749  
hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thewi_0446
Enzymes [BR:twi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     Thewi_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
474267..475166
Genome map
AA seq 299 aa AA seqDB search
MKKVIKVGSRSSELALVQTQMVINEIKKFRQDFEFEIVKITTQGDALIDKPISEIGGKGV
FVKEIESALLKGEIDMAVHSMKDMPYEIPEKLKLMAVLKREDPKDVFVSRNGTKFIDLKK
GAKIGTSSLRRQVQLKALRPDIQIVPIRGNVRTRLKKMEELNLDGIVLSAAGLHRLGLES
IITEYFPPDVVVPAPCQGILAVEIAESFDNIFQEFYPYIVDRRTFFEASVERELLKVFGV
NCRQPFGAYAQYGRENDGEKIDIKVAYQKEDKLLKSEMTGLIVETDKMIEKLIKEFGGI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttataaaagtcggctcaaggtcaagtgaattggctttagtacaaactcaa
atggttataaatgaaataaaaaagtttaggcaggattttgaatttgaaatagtaaagata
accacacagggggatgcattaattgacaaacctattagtgaaatagggggaaaaggggtt
tttgtaaaagaaatagaaagtgcattgctcaaaggtgaaattgacatggcagtccacagc
atgaaggacatgccttatgaaatacctgaaaagctcaagctcatggcagttttaaaaaga
gaagacccaaaggatgtgtttgtttcaagaaatggaacgaaatttatagatttaaaaaaa
ggggctaaaattgggaccagcagtttaagaaggcaagtgcagcttaaagctttaaggcca
gatatacagattgttccaataagaggtaatgtgaggacgaggctcaaaaaaatggaagaa
ctaaaccttgacggcattgttttatcagcggcgggtttgcacaggttaggattggagagt
attattactgaatatttcccacctgatgtagttgtaccagcaccttgtcagggaattctt
gcagtagaaattgcagaaagttttgataatatatttcaagagttttatccctatattgtt
gatagaagaacattttttgaggcttctgttgaaagggaacttctaaaagtctttggagtt
aattgcagacagccttttggtgcctatgcccaatatgggagagagaatgatggagaaaaa
atagacataaaagttgcttatcaaaaagaggataagcttttaaaaagtgaaatgactggc
ttaattgtagaaaccgataaaatgatagaaaagcttattaaagaatttggaggtatatga

DBGET integrated database retrieval system