KEGG   Thermoanaerobacter wiegelii: Thewi_0448Help
Entry
Thewi_0448        CDS       T01607                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thewi_0448
Enzymes [BR:twi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Thewi_0448
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thewi_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
476674..477648
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRANSILRDMIRETSLDVGDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
IEEVREVRNLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVLNDKTVYYIAKIALSHIEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADMVITYFAKDVAKWLTTL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttagagcgaacagcattttaagggatatgata
agagaaacttctttagatgtaggtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttatcatttttctatagatttgctt
atagaagaagttagagaagtgcgtaaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattggggtcagaggcttatagtgaggaaggcatcgttcaaaaa
gcggtgagagaaataaaagaaaaagtgccagaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaattcatggacactgtggcattgttgaaaatggccaagttctaaatgac
aaaacagtgtactacattgctaaaatagccttgtcccatattgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaacacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaactccaatgaagccttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaaacctgcactttcttatcttgatattataaggcgggtaaag
gataatttcaatattcctattgctgcttacaatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatacttacttcg
attaaaagagcaggagcagacatggttataacctactttgcaaaggatgttgcgaaatgg
cttactaccctgtaa

DBGET integrated database retrieval system