KEGG   Thermoanaerobacter wiegelii: Thewi_0450Help
Entry
Thewi_0450        CDS       T01607                                 

Definition
(GenBank) PilT protein domain protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(478194..478595)
Genome map
AA seq 133 aa AA seqDB search
MEKIWIDANVILRYLLKDNEEFYAKAYEIMKKADSGELKLLVSPLTIAEVVWTLESFYKI
SKDQISDTLITFICSEAVEAEERDTLILSLNSYRENNVDFIDAYIAAHAINSGNKKVFTF
DKKHFSRLNVELF
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatatggattgatgccaatgtcattttgagataccttttaaaggacaatgaa
gaattttatgcaaaagcgtatgaaattatgaaaaaagcggacagcggagaattaaaactt
ctcgtatctcctctcactattgcagaagtagtatggacacttgagtctttctacaaaata
tcaaaggatcaaatatctgatacgcttattacctttatatgttctgaagctgtggaagca
gaagaacgggacacattaattctatctctaaacagttatagagaaaataatgttgatttt
attgatgcgtatatagctgcccatgcaataaattcaggaaacaaaaaagtatttactttt
gataaaaaacatttctcaaggcttaacgtagaattattttaa

DBGET integrated database retrieval system