KEGG   Thermoanaerobacter wiegelii: Thewi_0459Help
Entry
Thewi_0459        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
  KO
K07403  
membrane-bound serine protease (ClpP class)
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(join(484332..485048,485048..485659))
Genome map
AA seq 442 aa AA seqDB search
MFKLRKILLFIILLIFVILPLSSLKAVPPQSPVYVLSIDGPIVPVVADYIESGLQEAEKN
GASCIVIELSTPGGLYSTTQKIVTKILNSHIPVVVYVSPAGAWAGSAGTFITLSANVAAM
APGSRIGAAHPVSMEDDSALSDVQRQKLTHDAAAWIRSIAENRGRDPKNAEMAVIESKSF
TDTEALNAHLVDFKATNLNDLLKKINGLTVKNFDGTTTTLQTDGPIKYFPMSSAQKFLFA
ISDPNIAYLLMSAGILGIVLELYHPGAIFPGVAGGISLLLGLYTLGTLNAQLSGMLLVIL
GLVLLASEAFVVSHGILAVGGITSFVLGSLMLFSGNQMGLTINKGVVFATAFFMAAFVSF
LLAAVIKAQKRKVVTGVEGLIGEIGIAVSDINPNGIVLVEGERWQAESKEYIAKGEKVVI
TAVEGLTVKVEKIKEGGSKKND
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaattaaggaaaattttactatttataatcttgttaatttttgttatactgcca
ctttcttctttaaaagcagttccgccccaaagccccgtttatgtactatccattgatggc
cctattgtaccagttgtcgctgattacattgaaagcggtcttcaggaagcagaaaaaaat
ggtgcaagttgtatagtcatagaactttctacacctggcggtttgtattctactactcaa
aaaatcgtcacaaaaatactaaattctcatattcctgttgtagtatatgtctctcccgca
ggagcttgggcgggctctgctggtactttcataacactttcagcaaatgtcgctgcaatg
gctcctggaagtagaataggcgccgcccatcctgtgtcaatggaagacgactctgcttta
tcagatgtacaaaggcaaaaactcactcatgacgctgctgcctggataagaagcatcgca
gaaaacagagggagagaccccaaaaatgctgaaatggcagttattgaaagcaaatctttt
actgacacagaagcattaaatgcccatttagtcgattttaaagctactaatttaaatgac
cttctaaaaaaaataaacggccttacagtcaaaaattttgacggcacaactacaactttg
caaactgatggtccaatcaaatacttcccaatgtcttcagctcaaaaatttctctttgca
ataagcgatccaaatattgcttatcttctcatgagcgctggtatcttgggcattgtattg
gagctttatcatcctggggctatctttcccggtgtggcaggaggaataagcttactttta
ggcctctacacacttggaacattaaatgctcaattaagtggaatgcttcttgtcatatta
gggcttgtgcttttggcatctgaagcctttgtggtaagccatggaattttagcagtgggc
ggtataacttccttcgtacttggctctttaatgttatttagtggaaaccaaatgggactc
actataaacaaaggagtagttttcgcaacagcctttttcatggcagcttttgtttctttc
ctcttagctgctgttataaaagctcaaaagagaaaagtagtcacaggagtagaaggtcta
attggtgaaataggtattgcagtaagtgatattaatccaaatggcatagtcttggtagaa
ggagaaaggtggcaggcagaatctaaagagtatattgcaaaaggcgaaaaggtggtcatt
acagcagtagagggtttgacagttaaagttgaaaaaataaaagagggaggcagtaaaaaa
aatgattga

DBGET integrated database retrieval system