KEGG   Thermoanaerobacter wiegelii: Thewi_0460Help
Entry
Thewi_0460        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
485722..486087
Genome map
AA seq 121 aa AA seqDB search
MIGRNFFERFTPQEIDLAIKLAPRSVITSTLINNTLSWIFIVLALYAVIKWVFRGKADVA
QLFSITGYAYTPVLIYFLICFIASFFTGQLYVNMSLALLVPSLKGTTIYGFLRSIDPFMV
W
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgattggcagaaatttttttgaaagatttacgccacaggaaatagatttagctattaag
ttggcgccaagatctgtaataacttctacgcttataaataatacactttcgtggattttt
atcgtgttagctctttatgctgtaatcaaatgggtatttagaggaaaagcggatgtagca
caattattttcaattactggttatgcctatactcctgttttaatatattttctaatatgc
tttattgcatccttttttacgggacaactttatgtgaatatgtctttagcattgcttgtt
ccttccttaaaaggaactactatatatggctttttaaggagtattgatcccttcatggtg
tggtag

DBGET integrated database retrieval system