KEGG   Thermoanaerobacter wiegelii: Thewi_0464Help
Entry
Thewi_0464        CDS       T01607                                 

Definition
(GenBank) ABC transporter related protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
twi  Thermoanaerobacter wiegelii
Module
twi_M00254  ABC-2 type transport system
Brite
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Thewi_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA cobW RsgA_GTPase AAA_14 HRXXH TsaE
Motif
Other DBs
NCBI-ProteinID: AEM77939
JGI: Thewi_0464
UniProt: G2MW51
Position
488032..488760
Genome map
AA seq 242 aa AA seqDB search
MLTVKNLYKKYNKSKAIASNNISMDINKGEIVGLLGPNGAGKTTLLKIICGLTIPDSSEV
IISNIKMEDKTRLKIMEKIGVVLEGNKNLYWAISVLDNYYYFGSIKGKTMGEIKKNIEKY
EDILKTKELLIRKVNTLSMGQKQRVAITASLLHELEPLILDEPSNGLDIESRILLTNAIK
TLREEMKITVLIASHDTDFLRKTVDRFIIINNGNIVDEFENTNITAEDIENKYKIHTNLK
EV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
ttgcttactgttaaaaatttatacaaaaaatacaataaaagcaaggctatagcttcaaac
aatatatctatggatataaataaaggggaaatagtaggacttctcggcccgaatggagca
gggaaaaccactttactcaaaataatatgcggtttaacaattcctgattcaagtgaagtt
attatatctaatatcaaaatggaagacaaaactcgattaaaaataatggaaaaaataggc
gtagtacttgaaggcaacaagaatttatactgggctatttcggtccttgataattactat
tattttggaagtataaagggaaaaacaatgggagaaataaagaaaaatatagaaaaatat
gaagacattctaaaaacaaaagaattattaatacgaaaagtaaatacactttcaatgggg
caaaaacaaagggtagcgataactgcttctttgcttcacgagctggagcctttaattttg
gacgaaccttctaatggattagatatagaatcgcgtattttacttaccaatgctattaag
accttgagagaggagatgaagataacagtattgattgcttctcatgatactgacttttta
agaaaaacagttgacagatttataataataaacaatgggaacatcgttgatgaattcgag
aataccaatattacagcagaagacatagaaaataaatataaaatacatacaaatctgaag
gaggtttaa

DBGET integrated database retrieval system