KEGG   Thermoanaerobacter wiegelii: Thewi_0466Help
Entry
Thewi_0466        CDS       T01607                                 

Definition
(GenBank) Rhomboid family protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(489592..490275)
Genome map
AA seq 227 aa AA seqDB search
MFPIRDNIPSRRPPLITLLLIIINSLIFFTLSSASYSTFAGFVYKYGLIPAKITKLVISG
VPFSGSDLYPFITSMFLHGNTFHLISNMWILWLFGDNVEDRMGHIRFFIFYILSGVIAGV
FHLVFNPISPVPVVGASGAIAGVMGAYFVLFPSARIITLVPTFFLVPVFLPIPAVVYLFL
WFLTQLYSGTVYSAIGGTTVGGIAWWAHIGGFISGVLLNRLFLRDRY
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaatcagggataatataccaagcagacgaccacccctcattacgctcctgctc
ataataataaattcgctcatcttcttcactctttcaagtgcttcatacagcacttttgcc
gggtttgtttacaaatacgggcttataccagcaaaaattacaaaactggttatatccggt
gtaccgttttccggcagcgacttatacccttttatcaccagtatgtttcttcacggtaac
acatttcacctaattagcaacatgtggatactttggctgttcggagataatgttgaagat
aggatgggtcatataagattcttcattttctacatccttagtggggtaatcgcaggtgta
tttcacctggtttttaatcccatctcaccagtgccggtggtaggggcttctggagctatt
gcaggcgttatgggtgcatatttcgtattattcccgtcggcaaggataatcaccctggta
ccaacctttttcctggttccagtcttcctcccgatacccgccgtagtctatctcttccta
tggttcctgacccagctctattccggcacggtctactctgccattggtggtacaacggtt
ggtggaatagcctggtgggcgcacataggaggatttatcagtggtgtgttgttaaatagg
ttgttccttagagataggtattaa

DBGET integrated database retrieval system