KEGG   Thermoanaerobacter wiegelii: Thewi_0467Help
Entry
Thewi_0467        CDS       T01607                                 

Definition
(GenBank) transcriptional regulator, LuxR family
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
490589..491371
Genome map
AA seq 260 aa AA seqDB search
MDFLWPQGELLSSYKRCNIIGVDPSTTVPLIMLNPKELEIKIYENKKLIDTFYQSIEEEW
IIGEYLFLLTDVEGYLLEVKCSTKEERCIKDSGFKPGVSFKEESCGTNAISMAMRLKRLV
YIRPQEHYCNIFKRWYCIASPITTKDGEIIGYIDISTIDKKIANEIVMVIKLLGEKIANE
YEKRVREEELNKIKIKLNDKQMKILTLEAKGYKELAIAEALRIEVVTVKYHKRKIVEKLE
AKNIQEAVAKAIKLGLIEMN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggattttttatggccacagggggagttactttcttcttataaacgatgtaacataata
ggtgttgatccttcaacaactgtaccgttaataatgctaaacccaaaggagttagagata
aagatatatgaaaataaaaagcttatagatactttttaccagagtatagaggaagagtgg
ataataggagagtatctatttttgcttacagacgttgaaggatatttattagaggtaaaa
tgcagtacaaaagaagaaaggtgtataaaagattcaggctttaaaccaggggtatccttt
aaagaagaaagctgtggaacaaatgcaatttcaatggcgatgagattaaagcgattagtc
tatatcagaccccaagaacactactgtaacatatttaaaagatggtactgcattgcttcg
cccataacgacaaaagatggggaaataataggctatatagacatatctacaattgataaa
aagattgcgaatgaaatagtaatggtgataaaattgcttggtgaaaaaatagcaaatgaa
tatgaaaagcgggtaagagaagaagagctaaataagataaagattaaattgaatgataag
caaatgaaaatactgacattagaggcaaaggggtacaaggaattagccatagcagaagct
cttagaatagaagttgtgactgtgaaatatcacaaaagaaagatagtagaaaaacttgaa
gcaaaaaacattcaagaagcagtagcaaaagctattaagttgggtttaatagaaatgaat
taa

DBGET integrated database retrieval system