KEGG   Thermoanaerobacter wiegelii: Thewi_0471Help
Entry
Thewi_0471        CDS       T01607                                 

Definition
(GenBank) protein of unknown function DUF1648
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
493660..493983
Genome map
AA seq 107 aa AA seqDB search
MLKRVMRYLYKCGWMFLVITFIINIFAYKYLPESIPLQRDAFGNINYTVSKLEFIFFIPI
LQLFSYIAIKYPHAKGKRKISHGIYDIAAGVILLFFDIFLLYVFIRK
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaagagtaatgagatatttgtataagtgtgggtggatgtttctagttataacc
tttattataaatatttttgcatataagtatctacctgaaagtataccacttcaaagggat
gcttttggaaatataaattatactgtatctaagttggaatttatattttttatacctata
ttgcagttgttttcttatattgcaataaaatatcctcacgcaaaagggaaaaggaaaatt
tctcatgggatatatgatattgcagcaggggttatacttttattttttgacatttttcta
ttgtatgtttttatacgaaaatag

DBGET integrated database retrieval system