KEGG   Thermoanaerobacter wiegelii: Thewi_0472Help
Entry
Thewi_0472        CDS       T01607                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
494164..494640
Genome map
AA seq 158 aa AA seqDB search
MGLKIREAIISDYENLLLLVKEVHEIHYKARPDYYKDTDIPLDKEDFINKLSHTEYKIMV
AENENDEIAGYIIYKIKKIEEHPLLVDRVVVYIEDLCVAGRFKRKGIGKKLLESAIEYGK
EINASSIELTVWAFNEEAIKFYESLSFKPQSIKMEMIL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaaaattagagaagctattatttcggactatgaaaatttattattactagtg
aaggaagtgcatgagattcattataaagctaggccagattattacaaagataccgatatt
ccactggacaaagaagattttataaataagttgtctcacacagagtataaaattatggtt
gcagaaaatgaaaacgatgagatagcagggtatataatttataaaataaaaaagattgaa
gagcatccgcttcttgttgacagagtagtagtatatatagaagatttatgcgtagcagga
agatttaaaagaaaaggtattggaaagaaacttttagaaagtgctattgaatatgggaaa
gaaattaatgcttcttcaattgaattgactgtatgggcttttaatgaagaagcaataaaa
ttttatgaatccctgtctttcaagcctcaaagtataaaaatggaaatgattttataa

DBGET integrated database retrieval system