KEGG   Thermoanaerobacter wiegelii: Thewi_0474Help
Entry
Thewi_0474        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
495421..496131
Genome map
AA seq 236 aa AA seqDB search
MFKKFLMPVIIFSLFILAGCSQSAKPMEIGKIPWVGYQRLTYDIFENNKLIGTAEFIIEK
SQSTNTYEISSITKIDSAELSTSTSVTSDTLMPVSSYYNVMSPQGDIKIETTYKDKWNIK
AKTSKGEQNLTVKLPKYYYDNDSLLMIMRAYPFKIGAEFTIYDSIASTAQIVPITNKVVS
KEKVTAPYGEAECFRVELKAGTSRQYIWYSDDENKFLYQYDNGKLVYKLKEVKNNK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaatttttaatgccagttataattttttcattgtttattcttgcaggctgt
tcacagagtgcaaagcctatggagattggcaagattccttgggtaggctatcagaggctt
acctatgacatttttgaaaataacaaattaattggcacagcggaatttataattgaaaag
tctcaaagcacaaatacttatgagatatcatctattacaaagattgactcagcagagttg
agcacaagtacatcagttacgtctgatactttaatgcctgtaagttcttactacaatgtg
atgtcaccacaaggggatataaagatagaaactacctataaggataagtggaatattaag
gctaaaacttccaaaggggagcagaatctaactgtaaaacttcctaaatattattatgac
aatgattctcttcttatgattatgagggcatatccctttaaaataggagcagagtttact
atatacgattcaatagcttcaactgctcagatagtgcctattacaaataaagttgtatct
aaagagaaagttactgccccttatggagaagcagaatgctttagagttgaattaaaggct
ggaacatcaagacagtatatatggtattcagatgatgaaaataagtttttgtatcaatat
gataatggaaaacttgtgtataagctaaaagaagttaaaaataataaataa

DBGET integrated database retrieval system