KEGG   Thermoanaerobacter wiegelii: Thewi_0491Help
Entry
Thewi_0491        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
506347..506943
Genome map
AA seq 198 aa AA seqDB search
MNEVINKMDIYIQKELKEKTVRILFLTLLLFIPVLLIKTIALLFLSATFIVYDIRHQNAE
LLYFLPFSKKELFLYNLIFLSLVVIVTSAIGEIFLGVHFINKFEPILRSLILLLAIFGLQ
MTFSGFEMDGLGWSAFIVFLDALFGYMGTTDINSFAFNPYSLISFTRQGNLLLSLIFSLL
DMLSMSFTEIDLSGRKFS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgataaataaaatggatatttatatacagaaagaattaaaggagaaaact
gtaagaatactttttcttactcttctactattcataccagtattattaatcaaaacaatt
gcacttttgtttttgtctgccacttttatagtgtatgatataagacatcaaaatgcagaa
cttttatacttcctacctttttctaaaaaagaattgttcctttacaatctcattttctta
agccttgttgtgattgtaacttctgctattggagaaatatttttaggagtccattttata
aataaatttgagcctattttgagaagtttaatacttttacttgcaatatttggacttcaa
atgactttttcaggctttgagatggatggattaggttggagcgcttttatagttttctta
gatgcgcttttcggatatatgggcacaacagatatcaatagctttgccttcaatccttat
agtttaataagttttacacgacagggcaatttactgttatccttaatattctctttacta
gatatgctatctatgtcttttactgaaattgatttatccggcagaaaattttcatga

DBGET integrated database retrieval system